KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008136
Entry
AgaP_AGAP008136   CDS       T01036                                 

Definition
(RefSeq) AGAP008136-PA
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aga03041]
    AgaP_AGAP008136
   03110 Chaperones and folding catalysts [BR:aga03110]
    AgaP_AGAP008136
Enzymes [BR:aga01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AgaP_AGAP008136
Spliceosome [BR:aga03041]
 Complex C
  Other components
   PPlases
    AgaP_AGAP008136
Chaperones and folding catalysts [BR:aga03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    AgaP_AGAP008136
SSDB
Motif
Pfam: Pro_isomerase RRM_1
Other DBs
NCBI-GeneID: 1277821
NCBI-ProteinID: XP_317325
VectorBase: AGAP008136
UniProt: Q7Q408
Position
3R
AA seq 676 aa
MSVVIETTIGDITVDLFLKERPRAALNFLKLCKLKYYNYNLFHTIQSDFIAQTGDPTGAG
DGGSSVWGILEGAEKRYFEGESVPKIKHSEPGLLSMVNAGEHLIGSQFFFTLGPDLTSLD
GRHTVIGEVTEGHEVLRKLNEVICDDRHRPYKDVRITHTVVLDDPFEDPRGFREPSRSPS
PSAERLQGGRIAADEEIDDLGGKTEQEIAEMIAEREAKARATILEIVGDIPDADIAPPEN
VLFVCKLNPVTTDDDLQIIFSRFGKIVGCEVIRDKLTGDSLQYAFIEFENQKSCEDAYFK
MDNVLIDDRRIHVDFSQSVSKIKWRGKGRGIEFKDGADKRSFKDYDRSRSRSRSRSRSKS
RSKSRSQSRSRSRSRSRSRSRSRSGSRSRARKVDRRQRSRSRDHMRDRDRNRPPGRNAQE
SNRGRKPNLTERNSAYMEQRNGRDIRINQGMVDYKNRPYPNSFVQRNGPRDKNAPRGGGR
SSRGALHWSDPLPPRRRSRSRDRRTRRSRSRSRSRDRRHSPPDRHAGSQRMHSREDRDRR
QHYGERSARSPSYSRQSRADKEYGRGEPAKQDRSRPEAKPVKRRSSSSGSSRSGSSEPKE
KRKRRSPSPDSVDSDSSSTSSSSSASDERAKKRKKKASKKKSKSSSKSSKKRKDSVSSDE
GKHRKKSKGKKKKKKH
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgtcggtcgtaatcgagaccacgatcggcgacatcacggtggacctgttcctgaaggag
cgtccccgggccgcactcaacttcctaaagctgtgcaagctgaagtactacaactacaac
ctgttccacacgatccagtcggactttattgcgcagacgggcgacccgaccggggccggc
gatggcggctcgtccgtgtggggcatcctggagggggcggagaagcgctacttcgagggt
gaaagcgtgccgaagatcaaacattccgagcccgggctgctgtcgatggtgaatgcgggc
gagcatctgattgggtcgcagtttttcttcaccctcgggccggacctgacctcgctcgac
gggcgccataccgtgatcggcgaggtgacggagggccacgaggtgctgcggaagctgaac
gaggtgatctgcgacgaccggcaccggccgtacaaggatgtgcgcatcacgcacacggtc
gtgctggacgatccgttcgaggatccgcgcgggttccgcgagccgagccggtcgccctcg
ccgtcggccgagcggctgcagggcggccggattgcggcggacgaggagattgacgatctg
ggcggcaagacggagcaggagattgcggaaatgattgccgagcgggaggcgaaagcgcgg
gccacgatactggagatcgtgggcgacatcccggacgcggacattgcgccgccggagaac
gtgctgttcgtgtgcaagctgaacccggtcacgacggacgacgatctgcagatcatcttc
agccggttcggcaagatcgtcgggtgcgaggtgatacgggacaagctgaccggcgactcg
ctgcagtacgcgttcatcgagttcgagaaccaaaagtcgtgcgaggacgcttactttaag
atggacaacgtgctgatcgacgatcgccgcatacacgtcgacttttcgcagtccgtatcg
aagatcaagtggcgcggcaagggccggggaatcgagttcaaggatggggccgataagcgg
tcgttcaaggattacgatcgatctcgttcccgatcacgttctcgatcgcgttccaaatcg
cgctccaaatcgcgttcccaatcgcgttccagatctcgttctaggtctcgttccagatcc
cgctccaggtccgggtctcgttcgcgtgccagaaaggtggaccgtcgtcagcgtagccgt
tcgcgcgaccatatgcgcgatcgggatagaaaccgccctccgggacgcaacgcacaggag
agcaatcgtggccgaaagccgaacctgaccgaacgcaactccgcctacatggagcagcgc
aacgggcgagacattcgcatcaaccagggcatggtggattacaaaaaccgtccctatccc
aacagcttcgtgcagcgtaacgggccgcgcgataagaatgcaccgcgcggcggcggtcgc
tcatcgcggggcgctttgcattggtccgatccactaccaccgcggcgtcggtctcgctcg
agggatagacgcacgagacggtcccgtagtcggtcgcggtcgcgtgaccgtcgccacagc
ccacccgaccggcacgccggtagtcagaggatgcattcgcgcgaggacagggaccgccgg
cagcattacggcgagcggtcggctcgaagcccctcgtacagccggcagtcccgggcggat
aaggagtacgggcgtggcgagccggcgaaacaggaccggtcgcgaccggaagcgaaacca
gtgaagcgacgatcgtccagcagcggctcttcgaggagcggcagcagcgagccgaaggag
aagaggaagcgtagaagcccgtcgccggattcggtggactcggacagttcctccacctcc
agctcgtccagcgcgtcggacgaacgggctaagaagcgcaagaagaaagcgtcgaaaaag
aaatcgaagagcagcagcaaatcgagcaagaagcggaaggactccgtttcctcggacgag
ggaaagcaccggaagaagtcgaaggggaagaagaagaaaaagaagcattaa

DBGET integrated database retrieval system