KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008332Help
Entry
AgaP_AGAP008332   CDS       T01036                                 

Definition
(RefSeq) AGAP008332-PA
  KO
K10739  replication factor A2
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03030  DNA replication
aga03420  Nucleotide excision repair
aga03430  Mismatch repair
aga03440  Homologous recombination
aga03460  Fanconi anemia pathway
Module
aga_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AgaP_AGAP008332
   03420 Nucleotide excision repair
    AgaP_AGAP008332
   03430 Mismatch repair
    AgaP_AGAP008332
   03440 Homologous recombination
    AgaP_AGAP008332
   03460 Fanconi anemia pathway
    AgaP_AGAP008332
DNA replication proteins [BR:aga03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AgaP_AGAP008332
DNA repair and recombination proteins [BR:aga03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AgaP_AGAP008332
   MMR (mismatch exicision repair)
     AgaP_AGAP008332
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AgaP_AGAP008332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon DUF4539
Motif
Other DBs
NCBI-GeneID: 1277651
NCBI-ProteinID: XP_317127
VectorBase: AGAP008332
UniProt: Q7PNC3
Position
3R
AA seq 247 aa AA seqDB search
MNDSFGAGGFNATAGGGGAGNENKAEGVLPLVIEQVLESSDGGISLFGHQYAMITLVAII
RNVDYSSTKVTYQLEDHTGRIDAHLWIEDDGVTSTPSIVPQSYARVVGSVRNQGGSKSIM
IFKIDQINSPNEVTTHLLEVLHARYKGEENSKRKVEGGFDTNANATSNGGFMESDSVGAS
LGLNGKQLAVYKAIKSHVSDIGISRKELQAKFSHISPSEMQSIIDHMGQEGMIYTTVDTD
HFFCVDA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatagctttggtgccggtggatttaacgcgaccgcgggcggcggcggtgcggga
aatgagaacaaagcggaaggcgtcctgccgctcgtcatcgagcaggtgctggaatcatcg
gacggaggcatttcgctgttcgggcaccaatatgcgatgattacgctggttgcaatcatc
cgcaatgtcgattactcctccaccaaagtcacctaccagctggaagatcacacaggccga
attgatgcacatctatggatagaggacgacggtgtcaccagcacgccgagtatcgtgccc
cagtcgtacgctcgcgtggttggatcggtgcgcaatcagggcggctcgaaatcgatcatg
atcttcaagatcgaccagatcaactccccgaacgaggtgaccacccatctgctggaggtg
ctgcacgcccggtacaagggcgaggagaacagcaagcgcaaggtggagggtgggttcgac
acgaacgccaatgcgacctcgaacggtgggttcatggaatcggactcggtcggtgcgtcg
ctgggcctgaacgggaagcagctggctgtgtacaaagcgatcaaaagccacgtatccgac
atcggcatcagccgcaaggagctgcaggccaaattttctcacatcagtccctcggagatg
cagagtatcattgatcatatgggacaggaaggcatgatatacaccacggtcgatacggat
catttcttctgtgtggacgcataa

DBGET integrated database retrieval system