KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP008527
Entry
AgaP_AGAP008527   CDS       T01036                                 
Name
(RefSeq) AGAP008527-PA
  KO
K06497  CD63 antigen
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    AgaP_AGAP008527
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP008527
   04090 CD molecules [BR:aga04090]
    AgaP_AGAP008527
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP008527
CD molecules [BR:aga04090]
 Proteins
  AgaP_AGAP008527
SSDB
Motif
Pfam: Tetraspanin DUF4179
Other DBs
NCBI-GeneID: 1277446
NCBI-ProteinID: XP_316915
VectorBase: AGAP008527
UniProt: Q5TQJ1
Position
3R
AA seq 234 aa
MPSLGISCVRYMVFFFNFLFAITGLVVIVTGAIIQSNYYHYSNFVGDNFWTAPIVLIVIG
SIIFVVACFGCCGAAKESPCMIITFSIFLALVFLAEIGIGIAGYYKHEELSGILEKGFNK
TLDSYATDKGAQEAWNLVQSEMVCCGIKGPEDWEPIYKNDTVPRACCHRMPVGVNKCTRE
YASTEGCFSKLSSYLGSKSLILAGIGIGLAIVQLIAVLLACCLYGSFRRQYETV
NT seq 705 nt   +upstreamnt  +downstreamnt
atgccttcgttagggatatcgtgtgtacgctatatggtgtttttcttcaacttcctgttt
gcgatcaccgggctggtcgtgattgttacgggagccatcattcaatcgaattattaccat
tactcgaactttgtcggtgacaacttctggaccgcaccgatcgtactcatcgtcatcggg
tcgatcatcttcgtcgtggcatgcttcggttgctgcggtgccgccaaggagagcccgtgc
atgatcatcaccttttccattttcctggcactggtgttcctggccgagatcggcatcggc
atcgccgggtactacaagcacgaagagctgagcggcatactggagaagggcttcaacaag
acgctggacagctacgccacggacaagggcgcccaggaggcgtggaatctcgtgcagtcg
gagatggtgtgctgcggtattaagggaccggaggactgggaaccgatctacaagaacgac
acggtgccgcgggcctgctgccaccggatgccggtcggtgtgaacaagtgcaccagggag
tacgcctcgacggagggctgcttctcgaagctgtccagctatctcggctcgaaatcgctc
atcctcgccggcattggcatcgggttggccattgtgcagctgattgctgtcctgctggcc
tgttgtctgtatggatccttccgccgtcagtacgagaccgtctaa

DBGET integrated database retrieval system