KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP008689
Entry
AgaP_AGAP008689   CDS       T01036                                 
Name
(RefSeq) AGAP008689-PA
  KO
K10409  dynein axonemal intermediate chain 1
Organism
aga  Anopheles gambiae (malaria mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:aga03037]
    AgaP_AGAP008689
   04812 Cytoskeleton proteins [BR:aga04812]
    AgaP_AGAP008689
Cilium and associated proteins [BR:aga03037]
 Motile cilia and associated proteins
  Dynein arm
   AgaP_AGAP008689
Cytoskeleton proteins [BR:aga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     AgaP_AGAP008689
SSDB
Motif
Pfam: WD40 BBS2_N Ge1_WD40 Sp-CxC
Other DBs
NCBI-GeneID: 1275533
NCBI-ProteinID: XP_314788
VectorBase: AGAP008689
UniProt: Q7Q8D1
Position
3R
AA seq 727 aa
MQKIGKGEPVDNDEFDTWMKSKQLLKPDDQLDLTEAELGEEIPKLLSTENRHLPRNLVVY
DFREGAFLPVPPPENTITLLEFEGTSIHKDTDEAKEQISRKGTDELNVTLDKPKETLAED
QEDTKKPDTPETGDGEEGEGMKVKRKALGKTNPLNQLQNKANPKSVQHRFEPFYEAEGEG
EGQEQEEEVQPPPEEEAPKKKLTNQFNFCERAALTIANPSRSVDTQTIPPPRSSYGASVL
QWVIYDSYIEDYAQQQREKEREKEKKPGLQRRDEKSRKDEKAKQAEEFNKRYLQACQIIE
RMVNQNIYDEIAQDYRYWEDPSDEFREEEGTLLPLWKFSYERTKKMCVTDLCFNTLYYDL
FAVCFGTLDFMKQNAEGAVCLFTIKNPSFPDYRIATESGAMCCDIHPKYPYLIAIGLYDG
NVIVYNLQVGTKEGPVYISHGVNGKHAECVWEIKWGPDMQDGEINFFSVSADGKVFNWVL
MQNKLAITTIITLFLELDQVSGPDGSTLRLKGSGTCMVFHPHNQEIFLVGTEEGYIFKCS
TAYSSKYLMTYHAHYLPVHRMDYNKFNSNIFASCSGDWRVKIWEDMRPEPLFIFDLGSSV
GDVKWAPYSSTVFAAVTTEGKVFVFDLNVNKYKAICTQAIVSKRKNKLTRLAFNQKLPFI
IVGDDKGTTITLKLSPNLRIKTKMGKKAGVVDPQLLESQKLDRLLSLVRELPEGETVKET
VSTVASN
NT seq 2185 nt   +upstreamnt  +downstreamnt
atgcagaagatcggcaagggagaaccggtcgacaacgatgagttcgacacgtggatgaag
tcgaagcagctgctcaagccggacgatcagctcgacctgaccgaggcggagctgggcgag
gagatcccgaagctgctgtcgaccgagaaccgccacctgccgcgcaacctggtcgtgtac
gacttccgggagggtgcgttcctgccggtgccaccgcccgagaacacgatcacgctgctc
gagttcgagggcacctccatccacaaggacacggacgaggcgaaggagcagatctcgcgc
aagggcaccgacgagttgaatgtcacgctggacaaaccgaaggaaactctcgccgaagac
caggaggacacgaaaaagcccgacacaccggaaactggtgacggcgaagagggtgaacgg
gatgaaggtaaagcgtaaagcattaggcaaaacaaaccccctaaaccaattgcaaaacaa
agcaaatcctaaatccgtgcagcatcgatttgaacctttttatgaagcggaaggtgaagg
cgaaggtcaagagcaggaggaagaagtacagcctccgccggaagaggaagctccgaagaa
gaagctcacgaatcagttcaacttttgtgaacgtgccgccttgacgatagcgaacccgtc
acggtccgtcgacactcaaacgataccaccgccaagatcatcgtacggtgccagcgtact
ccagtgggtgatctacgattcgtacatcgaggattacgcgcagcagcagcgcgagaagga
acgggagaaggagaaaaagcccggcctgcagcggcgcgacgagaagagccgcaaggacga
gaaggccaaacaggcggaagagtttaacaagcgctacctgcaggcgtgccagatcatcga
gcggatggtgaaccagaacatttacgacgagatcgcccaggactatcgctactgggagga
tccgtccgatgagttccgcgaggaggagggcacactgctgccgctgtggaagttctccta
cgagcggacgaagaagatgtgcgttaccgatctttgcttcaacacgctgtactacgatct
gtttgccgtctgctttgggacactggactttatgaaacaaaacgctgaaggtgccgtttg
cttgtttaccataaaaaatccctccttcccggactatagaatcgccaccgaaagtggtgc
catgtgctgcgacattcaccccaagtacccgtacctgattgcgatcggcctgtacgatgg
gaacgtgatcgtgtacaacctgcaggtcggtacgaaggagggcccggtctacatctcgca
cggcgtcaacggcaaacacgcggagtgcgtgtgggaaatcaagtggggcccggacatgca
ggatggcgaaatcaactttttctccgtgtcggccgacgggaaggtgttcaactgggtgct
gatgcagaacaagctggccattaccacgatcattacgctgtttctcgagctggatcaggt
cagcggtcccgatggcagtacgctgcggttgaagggtagcggcacttgcatggtgttcca
tccgcacaatcaagaaattttcctcgtcggtacggaggaaggatacatctttaagtgcag
cacagcgtacagctcgaaatatctaatgacgtatcatgcacactatctgccggtgcatcg
gatggattacaacaagttcaattcgaacattttcgcctcctgcagtggcgattggcgggt
gaagatatgggaagatatgcgccctgaaccacttttcatcttcgatctgggctcctcggt
gggcgacgtgaagtgggcaccgtactcgagcaccgttttcgcggccgtcacgaccgaggg
caaggtgtttgtgttcgatctgaacgtgaacaagtacaaagccatctgtacccaggcgat
cgtttcgaagcgcaagaacaagcttacccggctggcgttcaaccagaagctgccgtttat
catcgtcggggacgataaaggcacaacaattacgctgaagctttcacctaacctacgcat
caagaccaagatgggcaagaaggcgggcgtcgttgatccgcagctgctcgaaagccagaa
gctggaccggttgctgtcgctcgttcgtgagctgccggaaggtgaaacggtcaaggaaac
tgtgtcgaccgtcgcatcgaactaa

DBGET integrated database retrieval system