KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008727
Entry
AgaP_AGAP008727   CDS       T01036                                 

Name
(RefSeq) AGAP008727-PA
  KO
K02263  cytochrome c oxidase subunit 4
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00190  Oxidative phosphorylation
aga01100  Metabolic pathways
Module
aga_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AgaP_AGAP008727
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 1275578
NCBI-ProteinID: XP_314839
VectorBase: AGAP008727
UniProt: Q7Q8A2
Position
3R:16158263..16159216
AA seq 182 aa
LKTETMANVNLASVVLRTALRAKIGTRQSHDMITQKIGKREVVGHGWNGLPVYADRVDYP
MPAIRFKENTRDVLALREKEKGDWKKMSVQEKKALYRASFCQTFAEMKHPTGEWKACLGA
ALIAASMSLIGMMLLKAFVYEPIPETFDEEHQKAQLKRMLDLNINPIHGVSSKWDYDNNK
WK
NT seq 549 nt   +upstreamnt  +downstreamnt
ctcaaaacagaaacgatggcgaacgtgaacctagcgtcggtggtgctccgcactgcgctg
cgtgcaaagattggcacccgccagtcccacgacatgatcacgcagaagatcggcaagcgg
gaggtggtcggacacggctggaacggtctgccggtgtacgctgaccgcgtcgactacccg
atgccggccatccgcttcaaggaaaacacccgtgacgtcctggctctgcgcgagaaggag
aagggtgactggaagaagatgtcggtgcaggagaagaaggccctgtaccgggcctcgttc
tgccagacgttcgccgagatgaagcacccgaccggcgagtggaaggcgtgcctcggcgcc
gccctgatcgccgcctccatgagcctgatcggcatgatgctgctgaaggcgttcgtgtac
gaaccgatcccggaaacgttcgacgaggagcaccagaaggcccagctgaagcgtatgctc
gacctcaacatcaacccgatccacggcgtgtcgtccaagtgggactacgacaacaacaag
tggaagtaa

DBGET integrated database retrieval system