KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008848Help
Entry
AgaP_AGAP008848   CDS       T01036                                 

Definition
(RefSeq) AGAP008848-PA
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00230  Purine metabolism
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP008848
Enzymes [BR:aga01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     AgaP_AGAP008848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase ANF_receptor HNOBA
Motif
Other DBs
NCBI-GeneID: 1279811
NCBI-ProteinID: XP_319590
VectorBase: AGAP008848
UniProt: Q7PWU5
Position
3R
AA seq 1025 aa AA seqDB search
LSCRKMTEMRDNGIVVFIGPDETCTSEALVASAWNLPMISYKCADIAVSDKTVYSSFART
LPPATKVSKSVAALLLANNWHCFSIVASKHPAWSMEIAHAIELQAELNNLTVNHFRIYSD
YIPSKIYELQEIVDNTYRNTRVYVFVGDHIEMVDFVRCLQNRKLLSTGDYIVISIDDEIY
DPNMKRNIYQGNYSDFYQKYIGNSKDKHQQNRKRYNYKDQERLQEAFQSVLRISPLFPMN
PKYRKLCHQFKLYSRKDPFRVPLPYNRHIFDEIQVPIYGAYLYDALIIYARAATEVLRDG
GDVSDGRLIMRHIFNRSYHSIQGFDVYIDANGDAEGNFSVIALQKDDKVNNSLHMSMQPV
ALFAYGARNATGTGTTLPEFRYLNPNRPIMWLKGRPPLAEPVCGFYNEKCRPKAKDWRYI
TGALVVILFMAIFTIILFKHYRYEQTLACLLWKVDMKDVILITSPDALYNNELRKNLVSR
IKYKELQINHFQRGEKVCQQSIMVNSAGDVNKRAYTTIGLYRGNIVAIKYLHKRTVDITR
NIRKELKQMREIRHENLITFVGASIDHGTVSILTSYCARGSLVDVLSNEDLKLDHMFVSS
LVSDIVKGLIYLHDSDVGSHGNLRSSKILIDSRWVAQIADFGLHEFKSCQEEPSKFEKEL
RRSLWKAPELLRDPNCPPKGTQKGDVYSFGIVLYEIIGRKGPWGDLNMSWQDIVARVMSP
EEYGIFRPSLRGIDAPEYVIQLLHSCWEEDPEDRPDIRLVRVKLKPMQAGLKPNIFDNML
AIMEKYAYNLEGIVQERTNQLSEEKKKTESLLLRMLPKSVAESLKRGERVEAECFDCVTI
FFSDLVGFTELCAQSTPFEVVEMLNDLYTCCDFIISSYDVYKVETIGDAYMVVSGLPLRN
GDRHAGEIASLALHLLNSISNLEIRHRPGEFIQMRIGIHSGQCVAGVVGLKMPRYCLFGD
TVNTASRMESNGEALKIHISSITYGLLKKLGGYKCEERGIIKVKGKGEMRTYWLLGEDDQ
KRMDR
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
ctttcgtgcaggaaaatgaccgaaatgcgcgacaatggaatagttgtatttattggaccg
gatgaaacctgcacctcggaggcactggtcgcgtccgcctggaacctgccgatgatatcg
tataaatgtgccgacattgccgtgtcggacaaaacggtgtacagcagcttcgcccgcacg
ctaccgccggcgacgaaggtatcgaagagtgtcgccgccctgctgctggctaataattgg
cactgcttcagcattgtcgccagcaaacatcccgcctggagcatggagatcgcgcatgca
attgagctgcaagccgagttaaacaatctcaccgtgaaccacttccgcatctattcggac
tacatcccgtccaaaatctatgagctgcaggagatagtggacaacacttaccgcaacaca
cgggtgtacgtgttcgtgggcgatcatatcgaaatggtggactttgtgcgctgcctgcaa
aaccgaaagctgctcagcacgggcgactacatcgtgatatcgatcgatgacgaaatctac
gacccaaacatgaagcgcaatatctatcaaggtaattattccgatttctaccaaaagtac
atcggcaactcgaaagacaaacatcagcagaaccgcaagcgctacaactacaaggaccag
gagcggctgcaggaagcgttccagtcggtgctgcgcatatcgcccctctttccgatgaac
ccaaagtatcgcaaactttgccaccagttcaagctgtactcgcgcaaggatccgttccgt
gtgccgttgccctacaatcggcacatatttgatgagattcaggttcccatctacggtgcg
tacctgtacgatgcactcatcatctacgcccgggccgcgacggaggtgctccgggacggt
ggtgacgtctcggatggaagattaattatgcgccatatattcaaccgctcgtaccactcg
atccagggattcgatgtgtacatcgatgcgaacggggacgccgagggcaacttttcggtc
atcgcgttacagaaggacgacaaagtgaacaactcactgcacatgtcgatgcaaccggtg
gcactgtttgcgtacggcgcacggaatgccaccggtaccggtacgacgctgcccgagttt
cgctacctcaacccgaaccgcccgatcatgtggctgaaggggcggccaccgctggcagaa
cccgtctgtggcttctacaatgaaaagtgtcgcccgaaggcgaaggactggcggtacatt
accggtgcgctggtcgtgattctcttcatggcgatatttaccatcatcctgttcaaacat
tatcgctacgagcagacgttggcctgtctgctctggaaggtggacatgaaggatgtgata
ctgataacatcacccgacgcactttacaacaacgaactacgaaagaatcttgtaagtaga
attaagtacaaggaattacaaatcaatcatttccaacgaggagaaaaagtatgtcaacaa
agcattatggtcaacagtgcgggagacgttaataaacgggcctacacgacgattggtctc
tatcgtggcaatatcgtcgctatcaagtatcttcacaagcgaaccgtcgatattacgcgt
aacattcgcaaagaactaaagcagatgcgagaaatacgccacgagaatctgatcacgttc
gtcggtgcatcgatcgaccacggtacggtaagcatcctgacgtcatactgtgcccgcggc
agcctcgtcgatgtgctttcgaacgaagatctcaagctagatcacatgttcgtctcctcc
ctggtgagcgatatcgtcaagggactgatctacctgcacgatagcgatgtaggatcgcac
gggaatttgcgatcgagcaagatcctaatcgattctcgctgggtcgctcaaatagcggac
tttgggctgcatgagtttaaatcctgccaggaggaaccaagcaagtttgaaaaagagctg
cgccgcagtctgtggaaagcgccggaattactgcgcgatcctaactgtccaccgaagggt
acgcagaagggcgacgtgtactcgttcggtattgtgctgtacgagatcattggacggaaa
ggcccatggggtgatcttaatatgagctggcaagatattgtagctcgcgttatgtcaccg
gaagagtatgggattttccgcccatcgctgcgaggcattgacgccccagagtacgtcata
cagctgctccactcgtgctgggaagaggatccagaagatcgaccagacatacgattggta
cgggtgaagttgaaaccgatgcaggccggactcaaaccaaacatatttgataacatgctc
gcgatcatggaaaagtatgcctacaacttggaggggatcgtacaggagcgcaccaatcag
ctgtcggaggagaaaaagaagacggaatcattgctgctaaggatgctgccaaagagtgtg
gctgagtcactaaagcgcggtgaacgggtcgaggcggaatgtttcgactgtgtgacgatt
ttcttcagcgatctggtcggcttcacggaactgtgcgcccaaagcacacccttcgaggtg
gtggaaatgctgaacgatctctacacctgctgcgactttatcatctccagctacgacgtg
tacaaggtggaaacgatcggtgacgcgtacatggtcgtgtcgggactgccgctccggaac
ggtgatcgacatgcgggagagatcgcttcactggccttacatctgttgaattccatctcg
aacctggagataaggcaccggccgggggagtttattcagatgcgcattggcatacattcg
ggccagtgcgtggccggtgttgtggggctgaagatgccccggtactgtctgttcggggat
acggttaatacagcctcccggatggaaagtaatggtgaagcgctgaaaattcacatctct
tcaataacgtacgggttgttgaagaagctcgggggttataagtgtgaggagcgaggcatt
attaaggtgaaagggaagggtgaaatgcgaacctactggttactcggcgaagacgaccaa
aagcggatggatcgg

DBGET integrated database retrieval system