KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP009094
Entry
AgaP_AGAP009094   CDS       T01036                                 
Name
(RefSeq) AGAP009094-PA
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00730  Thiamine metabolism
aga01100  Metabolic pathways
aga01240  Biosynthesis of cofactors
aga04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AgaP_AGAP009094
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    AgaP_AGAP009094
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aga03016]
    AgaP_AGAP009094
   03029 Mitochondrial biogenesis [BR:aga03029]
    AgaP_AGAP009094
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:aga02048]
    AgaP_AGAP009094
Enzymes [BR:aga01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     AgaP_AGAP009094
Transfer RNA biogenesis [BR:aga03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    AgaP_AGAP009094
 Prokaryotic type
    AgaP_AGAP009094
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    AgaP_AGAP009094
Prokaryotic defense system [BR:aga02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   AgaP_AGAP009094
SSDB
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC
Other DBs
NCBI-GeneID: 1280047
NCBI-ProteinID: XP_319845
VectorBase: AGAP009094
UniProt: Q7PW45
Position
3R
AA seq 446 aa
MLSRWSRLVTDKKLTIQLLRSTGHGTTRNYGTDKKFSIKDEVLDGRPLYLDAQATTSMDP
RVLDAMMPYLTAYYGNPHSRTHAYGWETEEAVEKARAQVASLIGADPKEVVFTSGATESN
NISVKGIGRFYGVKKKHIITTQTEHKCVLDSCRALEGEGFHVTYLPVQSNGLISMEELEK
AITPETSLVSIMTVNNEIGVKQPIAEIGRLCKAKKVFFHTDAAQAVGKIPLDVNKMNIDL
MSISGHKIYGPKGIGALYVRRKPRVRVEAIQSGGGQERGLRSGTVPTPLAVGLGAACEIA
AREMAYDHRWMEFLSKRLMDKIFAELPQVIRNGDPVQSYPGCINLSFAYVEGESLLMALK
DVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTIEEVDYTAEKCIKHVT
RLREMSPLWEMVQEGVDIKSIKWSQH
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgttgtcacgctggtcgcgcttagttactgataaaaaactaaccatccaactgctgcgc
agtacgggtcatggaacgacacggaattacggcaccgataaaaagtttagcatcaaagac
gaagtactagatggccggcccctctacctggatgcccaagcgaccacatcgatggatccg
cgcgtcctcgatgccatgatgccgtacttgaccgcttactacggtaatccccactcgcga
acgcacgcgtacggctgggagacggaggaagccgtagagaaggcccgcgcacaggtcgct
tcccttattggggccgatccgaaggaggtcgtgtttacgtccggcgccacagaatcgaac
aacatctcggtgaagggtattgggcggttctatggcgtgaagaaaaagcacatcatcacc
acacagaccgaacacaagtgcgtgctggattcgtgccgtgcgctggagggagaaggcttt
cacgtcacctatctcccggtacaatcgaacggtctcatcagcatggaagagctggagaaa
gcaatcacaccggaaacatcactcgtgtccatcatgacggtcaacaacgagattggcgtg
aagcaaccaatcgcggagatcgggcgcctgtgcaaggcgaagaaggtgtttttccacacc
gacgccgcgcaagccgtgggcaagataccgctggacgtgaacaagatgaacatcgatctg
atgtccatctcggggcacaaaatttacggccccaagggcatcggtgcgctgtatgtgcgg
cgcaagccgcgcgtacgtgtcgaagcgatccagagcggcggtggacaggagcgtgggctg
cgcagtggcaccgtaccgacaccgttggctgtcgggctgggtgccgcctgcgagatagcg
gcccgcgagatggcctatgatcatcggtggatggagtttctgtccaagcggttgatggat
aagatatttgcggagctgccgcaggtcatccggaatggcgatccggtccaatcgtacccg
ggctgcattaatctgtcgttcgcgtacgtcgagggtgagtcgctgctgatggcgctgaag
gatgtggcgctttccagcgggtccgcgtgtacgtccgcttcgctggaaccttcgtacgtg
ttgcgtgcgatcggtacggatgaggatttggcccacagctcgatacgcttcggaatcggc
cggttcacgacgatcgaggaggtggactatacggcggagaagtgcatcaagcatgtgacg
cggttgcgcgaaatgtctccactgtgggagatggtgcaggagggtgtcgatataaagagc
atcaagtggtcgcagcattga

DBGET integrated database retrieval system