KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009347Help
Entry
AgaP_AGAP009347   CDS       T01036                                 

Definition
(RefSeq) AGAP009347-PA
  KO
K09571  FK506-binding protein 4/5 [EC:5.2.1.8]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aga03110]
    AgaP_AGAP009347
Enzymes [BR:aga01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AgaP_AGAP009347
Chaperones and folding catalysts [BR:aga03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    AgaP_AGAP009347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_16 TPR_6 TPR_17 TPR_19
Motif
Other DBs
NCBI-GeneID: 3291954
NCBI-ProteinID: XP_559833
VectorBase: AGAP009347
UniProt: Q5TVJ4
Position
3R
AA seq 461 aa AA seqDB search
MEEYHDLSGDGGVQKRILQEGTGDERPSKGCSVSLHYTGTLDADGKKFDSSRDRNEPFQF
TLGTGSVIKAFDMGVASMRLGERCILRCAPEYAYGSSGSPPNIPPNATLNFELEILGWKG
EDLSPKSDGGIQRFIVQSGSSKKRPTAGGLVKVHLVGRHEGRVFEERDVEFCLDEGKEVG
VVAGVELALEKFHKEETARLLLKPQYAFGAQGNSELGVPPNATVEYTVTLTDFEALVERS
MMSQDEMLAQAKLLREKGTKYLKEEKHELALKLYNRALTYLYDQSKEGEAAKLAIYLNKI
LCLQKLNSHDEAKVACVEALKMDSKNVKALYRRGMSNLALGDLDRALQDFSAVSSAWMMG
ACVVLEIEPENKAALNQVTICKHKIKAYNDQQKKVFANMFTKFAQSDSKKAQEEQSRQPD
VMKQKFGEWGADEREHEPTRFEQENPDVIMLNDLHKQFRNM
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggaggaataccacgatctgtccggcgacgggggcgtccagaagcgcatcctgcaggaa
gggaccggcgacgagcgcccgtcgaagggctgctccgtctcgctgcactacaccggcaca
ctggacgcggacggcaagaagttcgactcgagccgggaccggaacgagccgttccagttc
accctcgggaccggctcggtcatcaaagcgttcgacatgggcgtcgcgtcgatgcggctg
ggcgaacggtgcatcctgcggtgtgcgcccgagtacgcgtacggcagctccggcagcccg
ccgaacattccgccgaacgcgacgctcaacttcgagctggaaatactgggttggaagggg
gaggaccttagccccaagtcggacggcggcatacagcggttcatcgtgcagtcgggcagc
agcaagaagcgccctacggcgggcggcctggtgaaggtgcacctggtcggccggcacgag
ggccgcgtgttcgaggagcgggacgtggagttctgtctggacgagggcaaggaggtgggc
gtggtggcgggcgtcgagctggcgctggagaagttccacaaggaggagacggcccggctg
ctgctgaagccccagtacgcgttcggcgcgcagggcaacagcgagctgggcgtaccgccg
aacgcgaccgtcgagtacacggtgacgctgaccgacttcgaggcgctggtcgagcggtcg
atgatgtcgcaggacgaaatgctggcccaggccaagctgctgcgcgagaagggcaccaag
tacctgaaggaggagaagcacgagctcgccctgaagctgtacaaccgggcgctcacctac
ctgtacgaccagtcgaaggaaggggaagcggccaagctggccatctatctcaacaaaatt
ctgtgcctccagaagttaaactcgcacgatgaagcgaaagttgcgtgcgtcgaagccctc
aagatggacagcaaaaacgtgaaggcgctgtacaggcggggaatgtccaatctggcactg
ggcgacttggaccgagcgctgcaagatttctccgctgtaagtagcgcgtggatgatgggc
gcgtgtgttgtgttggaaattgaaccagaaaacaaggcggccctgaatcaggtgaccatt
tgcaagcacaagatcaaggcctacaacgatcagcagaagaaggtgtttgccaacatgttt
acaaagtttgcgcagagtgactccaagaaagcgcaggaagagcagagccgccagccggac
gtgatgaagcaaaagtttggcgagtggggcgcggacgagcgcgaacacgagccgacccgg
ttcgagcaggaaaatccggacgtcatcatgctgaacgatctgcacaagcagttccgcaac
atgtga

DBGET integrated database retrieval system