KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP009415
Entry
AgaP_AGAP009415   CDS       T01036                                 
Name
(RefSeq) AGAP009415-PA
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00561  Glycerolipid metabolism
aga00564  Glycerophospholipid metabolism
aga01100  Metabolic pathways
Module
aga_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AgaP_AGAP009415
   00564 Glycerophospholipid metabolism
    AgaP_AGAP009415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aga01004]
    AgaP_AGAP009415
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     AgaP_AGAP009415
Lipid biosynthesis proteins [BR:aga01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   AgaP_AGAP009415
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-GeneID: 3291966
NCBI-ProteinID: XP_559898
VectorBase: AGAP009415
UniProt: Q5TVI1
Position
3R
AA seq 273 aa
MTTSNGELLGLAVMAFFIITLSTTARYYFKFFCFIAFSVVCAVGPVPLMLFRPRDYRNAL
IPAYLCIGFGKMLGASFTVRGKENINRNHGGIVLMNHQSALDLIVLAELWPIMGRSTVVA
KKEVLYMFPFGLACWLWGTLFIDRQNRDSAKSVINKEAKAINEKQAKLLFFPEGTRGNGD
KLLPFKKGCFHVAVESQAFIQPVVISKYHFLKSKAKIFNRGQNIIKILPEVSCAGLSKDD
IPALMERVQKMMQREYEQLSEESLSINNISEVH
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaccacatcgaacggtgagctgctcggtttggccgtcatggcgttcttcatcatcacg
ctgtcgacgacggcgcgctactacttcaagttcttctgcttcatcgcgttttccgtggtg
tgtgcggtcggtccagtgccgctcatgttgttccggccgcgtgactaccggaacgcacta
attccagcgtacttatgtatcgggtttggcaagatgctcggggcatcgtttacggtgcgc
ggcaaggagaacattaaccgcaaccatggcggtatcgtgctgatgaatcaccaaagtgca
ctggatttgattgtcctggccgagctgtggcccatcatgggccgctcgacggtggtcgcg
aagaaggaggtcctgtacatgttcccgttcgggttggcctgctggctctggggaacgctg
tttattgaccgtcagaaccgtgactcagccaagagcgtcatcaacaaggaagcgaaagcg
atcaatgagaaacaggcaaagctgcttttcttccccgaaggtacgcgcggcaacggtgac
aagctgctgccattcaagaagggatgcttccacgtcgccgtcgaatcgcaagccttcatt
caaccggtggtcatttcgaagtaccattttttgaaatccaaagcgaagatcttcaaccga
gggcaaaatatcatcaaaattctaccggaagtatcctgcgcgggcctttccaaggacgac
attccagcgctgatggagcgggtacagaagatgatgcagcgggagtacgaacagctgtcg
gaggagtccctttcgattaacaatattagtgaggtgcattag

DBGET integrated database retrieval system