KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP009621
Entry
AgaP_AGAP009621   CDS       T01036                                 
Name
(RefSeq) AGAP009621-PA
  KO
K01204  alpha-N-acetylgalactosaminidase [EC:3.2.1.49]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aga01100  Metabolic pathways
aga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AgaP_AGAP009621
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    AgaP_AGAP009621
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.49  alpha-N-acetylgalactosaminidase
     AgaP_AGAP009621
SSDB
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase_C Melibiase
Other DBs
NCBI-GeneID: 1278996
NCBI-ProteinID: XP_318652
VectorBase: AGAP009621
UniProt: Q7Q1V0
Position
3R
AA seq 432 aa
MKRATMLLATVLCIGVLPACIYSLENGLARTPPMGWLSWERFRCNTDCEGDPENCISEHL
FRTMADLVVSEGYAAVGYEYINVDDCWLEKSRGPRGELVADRRRFPSGMKALANYVHAKG
LKFGIYEDYGNYTCAGYPGILGFSANDAAQFASWDVDYVKLDGCYSLPIDMDHGYPEFGR
NLNATGRPMIYSCSWPVYQIYAGMNPNYSSIIQHCNLWRNYDDIQDSWASLESIIDYYGN
NQDAIIPNAGPGHWNDPDMLIIGNFGLSYEQSKTQMALWAIMAAPLMMSVDLRTIRPEFK
AILQNRKIIAVDQDPLGIQGRRIYKHKGIEIWSRPITPIYQTYYSYAIAFVNRRTDGTPS
DVAVTLRELGLISPTGYRVEDLYEEVDYGVLSPQTKIKVKVNPSGVVILRADVQPERFSK
RPYNPIFYRYPN
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaagcgcgccacgatgctgctcgccaccgtgctgtgcattggcgtgctgccggcctgc
atctacagtctcgaaaacggtctcgccaggacgccaccgatgggatggctgtcgtgggag
cgcttccgctgcaatacggactgcgagggtgatccggaaaattgtatcagtgagcaccta
ttccgtacgatggccgacctggtcgtgagcgaaggatatgccgccgtcggctatgagtac
atcaacgtggacgactgctggctggagaagtcgcgtggaccgcgcggtgagctggtcgcc
gaccggcgtcgcttccccagtggcatgaaggcgctggccaattacgtccacgccaagggc
cttaagttcggcatttacgaagactacggcaactacacgtgtgccggatatccgggaatt
ctgggcttctcggcgaacgatgccgcccagttcgcttcctgggacgtggactacgtcaag
ctggacgggtgctactcgctgccgatcgacatggaccatgggtatccggagtttggccgc
aatctgaatgccaccgggcgcccgatgatctactcctgcagctggccggtttatcagatc
tacgccggcatgaatcccaactactcgtccatcattcagcactgcaatctgtggcgcaac
tatgacgacatccaggactcgtgggcctcgttggagagcatcatcgattactacggcaac
aatcaggatgccatcatcccgaacgctggcccggggcattggaacgatccggacatgttg
atcatcggcaacttcggactcagctacgaacagtccaaaacacagatggcgctttgggcg
attatggctgcaccgctgatgatgtccgttgatctgcgcacgatccggcccgagtttaag
gcgattctgcagaaccgcaaaattattgcggtcgatcaagatccactcggcattcagggg
cgaagaatctataagcacaagggcatcgagatctggtcccgaccgatcacaccgatctac
cagacgtactactcgtacgcgatcgccttcgtcaaccggcgaacggacggcaccccgtcg
gatgtggccgtgaccctgcgcgagctgggcctcatttcgcccacgggctacagggttgag
gacctgtacgaggaagtcgactacggagtgctgagcccccagaccaagattaaggtgaag
gtgaacccatcgggtgtggtgatactgcgggccgacgttcagccggagcgtttctccaag
agaccgtacaatccaatcttctatcgctatcctaactaa

DBGET integrated database retrieval system