KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010035Help
Entry
AgaP_AGAP010035   CDS       T01036                                 

Definition
(RefSeq) AGAP010035-PA
  KO
K07204  regulatory associated protein of mTOR
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04136  Autophagy - other
aga04140  Autophagy - animal
aga04150  mTOR signaling pathway
aga04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AgaP_AGAP010035
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    AgaP_AGAP010035
   04136 Autophagy - other eukaryotes
    AgaP_AGAP010035
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    AgaP_AGAP010035
Membrane trafficking [BR:aga04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    AgaP_AGAP010035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N HEAT WD40 HEAT_2 HEAT_EZ Atx10homo_assoc Cnd1 RTP1_C1
Motif
Other DBs
NCBI-GeneID: 5668290
NCBI-ProteinID: XP_001689178
VectorBase: AGAP010035
UniProt: A7UV57
Position
3R
AA seq 1295 aa AA seqDB search
DALLPVCFNCERHRGKILGINCTTQCWRVRDRMKTVSVALVLCLNIGVDPPDVVKIDKCA
RVECWINPASYSPGKALEMISYQLQKQYERWQPRARYRHSLDPTMEDVKKLCTSLRRNAK
EERVLFHYNGHGVPRPTANGEIWVFNRNFTQYIPLSIYDLQTWMGAPSIYVYDCSNAGII
VNSFHTFADQHELEVEHIRNRSGSTVGHTGGDLQAEDSRSSPSPSTGGAGTTTYRNCIQL
AACAADQLLPMNPNLPADLFTSCLTTPVKMALRWFTLQSTSKLVPEVTEELIEKIPGQLN
DRRTMMGELNWIFTAITDTIAWNTLRPELFQKLFRQDLLVASLFRNFLLAERILRAYDCT
PISSPALPPSYRHPMWSAWDLALDQALAQLPDVLEKGKPFQHSPFFEEQLTAFQVWLEGS
TEQRSPPEQLPIVLQVLLSQVHRLRALELLGHFVDLGPWAVNLALSVGIFPYVLKLLQSS
AKELRPCLVFIWAKIVAVDGTCQIDLIREQGHKYFLIALQDTNPGGQPFKGNHRTYAAFV
LASIVHNFPNGQSSALQGQLVSICLDQLNDDSNPLLRQWLAICLGHLWQNYEQARWSGVR
DNANEKLYPLLSDPYPEVRAAAVYALGTFISSVKQRSDHANNIDRSTAMHLFSTVSNDMS
PLVRMELIAALQWMVLFFESQFAGTFLQLDSPERTTNPMKRVLSTSNIIGVGKASVMVGF
YQKLWNGFIALSKDPFPEVASMAQKVVDYVRADSAKEVTVCDKSSHHYGSAASVSLPPSP
NTRVGYLAGESPPTHGGIHGPSDNGGSHHRLANQQTPLAMKKRIHAVNDSPAAGPDYTDS
PDKLAYSQSSSHSLSSSTAPLKPIVGTQYIEWSVSFFAQPSKRMNEAKAAGTDHNSYEFL
IRKSRWLRNKEVRAEGRTQRMKAIFKRLDVQSWSCRTQHAPTFIKLNPYDEQVAFAYNNL
SSSSTSSGYHSLQHHGSHRLINQSFLEQHHPTPSQSQQPSLSSFPHQLKPSNEPLPAHGF
GNHALAVTSLEFLNAHDVGVIMAGYSDSTIRLWRPKETSDENQLLSAWHGLLDFNTSSAA
KVSCSEAAPAAHGGLVLAWHQRTQTIMAAGEAKYIRLWDAEREMRICDIPSGSDTAVLKL
SCAPNGIFAAGFYDGSVRIFDRRCPPAETRCATIREHINPVLAICLRDDCESLVTADVSA
SVRLYDIRKAYSSVQNWSAGTDVSAMAIHTSADILACATSQIVIYGLDGVVLSSGRSNEG
FMAPRKGVASCLSFHKYKLNLAAGYNDNTAAVLVP
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
gatgctttgttgccggtctgtttcaactgtgagcgacatcggggcaagatccttggcatc
aactgcacgacccaatgttggcgtgtacgagaccgcatgaaaacggtgagcgtggcgctg
gtgctgtgcctcaacatcggtgtcgacccgccggatgtggtcaaaatcgacaagtgtgcg
cgggtagagtgctggatcaatccggcatcctactcgcccgggaaagcgctagagatgatc
agttaccagctacagaagcagtacgaacggtggcagcctcgcgcccgctatcggcactca
ctcgacccaacgatggaggacgtgaagaagctgtgcacctcgctgcgtcggaatgcgaaa
gaggagcgtgtgctgttccactataacggccacggtgtgccgcgtccgacggccaatggc
gaaatttgggtgttcaatcggaatttcacgcagtacatcccgctgtccatctatgacctg
cagacgtggatgggcgctccatcgatttacgtgtacgattgctcaaacgccggcattatc
gtgaacagttttcacacgttcgccgatcagcacgagcttgaggtggagcatataaggaat
cgaagcggcagcacggtgggacacacgggcggcgacctacaggcggaggatagtcgcagc
tcaccctccccttcgaccgggggcgctggaacgacgacgtaccggaactgtattcagctg
gcggcctgcgctgccgatcagttgctgccgatgaatcccaacctgccggcggatctgttc
acctcatgccttaccacgccggtcaagatggcgctacggtggtttacgcttcaatccact
tccaagctggtgccggaggtgacggaggagctgattgagaaaattcccggccagctcaac
gataggaggacgatgatgggtgagctgaactggatttttaccgccattacggacacgatt
gcgtggaacacgctgcggcccgaactgttccagaagctgttccgccaggacctgctggtt
gcgagcctgtttcgcaactttctgctggccgagcgtatcttgcgggcgtacgactgcacg
cccatctctagtccggcgttgccccccagctatcggcatccgatgtggtcggcgtgggat
ttggccctagaccaggcgctggcccagctgccggacgtgctcgagaagggaaaaccattc
cagcattcgcccttcttcgaggagcagctgacggcatttcaggtgtggctagagggaagc
accgagcagcgcagcccgcccgagcagttgccgatcgtgctgcaggtgctgctgtcgcag
gttcaccgattgcgtgccttggagttgttgggacactttgttgatctcggtccgtgggcg
gttaatctggcgctgagcgtgggcatctttccgtacgtgctgaagctcctgcaaagctcg
gccaaggagctgcgcccgtgtctggtgttcatctgggcgaaaatagttgcagtggatggg
acgtgccagatcgatcttatccgtgagcagggtcataagtatttcctgatcgccctgcag
gacaccaatcccggcgggcaaccgttcaagggcaatcatcgaacgtacgctgcgttcgtg
ctcgctagcatcgtgcacaacttcccgaacggacagtcgagtgcactgcaggggcagctc
gtgtccatctgcctcgatcagctgaacgacgacagcaatccactgctgcggcagtggttg
gccatctgcttggggcatctgtggcagaactacgaacaagcacggtggtccggcgtgcgg
gacaatgcgaacgaaaaactgtaccccctgctcagcgatccctatccggaggtgcgagct
gctgccgtctatgcgctgggcacgtttataagctcggtaaagcaacggtcggaccatgcg
aacaacatcgatcggtcgactgcgatgcaccttttctccacggtaagcaacgatatgagc
ccgctggtacgcatggagctgattgccgcgcttcagtggatggtgctgttcttcgagtca
cagtttgccggcacgtttttgcagctggacagccccgaacggaccaccaatccgatgaag
cgcgtcctaagcacgagcaatattattggcgttggcaaagcgtccgtcatggttgggttc
tatcagaagctgtggaacggattcattgccctgtcgaaagatcccttcccggaagttgcc
tcgatggcgcagaaagtcgttgactatgtgcgcgccgacagcgccaaggaggtgacggtg
tgcgacaaaagctcgcaccactacggtagcgcggccagcgtcagtttacctccgtcgccg
aacacccgtgtcggttatctagcgggcgagtcgcccccaacgcacgggggaatacacggc
cccagtgacaacgggggcagtcaccatcgtctggcgaatcagcagacgccactagcaatg
aagaagcgtatccacgcggtaaacgacagtccagcggccggaccggattatacggacagt
ccggataaattagcgtattcgcaatcgtcctcacactctctgtcgtcatcgacggctccg
ttgaagccgatcgtggggactcagtatatcgaatggtcggtcagcttctttgcccaaccg
tcgaagcgtatgaacgaagcgaaagcggccggtacggatcacaattcgtacgaatttctc
atccgcaaatcgcgctggttgcgcaacaaagaggtacgagcggaggggcgtacgcagcgc
atgaaggcgatctttaagcggctagatgtgcaaagttggtcctgccgtacgcagcatgca
ccgacgttcatcaagctaaatccttacgacgaacaagtggctttcgcatacaacaaccta
tccagcagcagcaccagctccggttaccacagtctgcagcaccatggttcgcatcgtcta
attaatcaatccttcctggagcagcaccacccgacgccctcacagtcgcaacagccatcg
ttatcatcgttcccgcaccaactgaagccatcgaacgagccgctgcccgcgcacgggttt
ggtaaccacgcactggcagtcacgtcgctggagttcctcaacgcgcacgacgtcggtgtg
ataatggccgggtacagcgacagcacgatacgattgtggcgcccgaaggagacgagcgac
gaaaaccagctgctttcggcgtggcacggtttgctagatttcaatacatcaagcgcagcc
aaggtaagctgtagcgaggcggcaccggccgcccacggcggtctggtgctcgcatggcac
cagcgcacgcaaacgataatggcggcgggtgaagcgaaatacatacgcctgtgggatgct
gagcgggagatgcgtatctgtgatattccgagcggctccgacacggccgtactgaagctg
tcctgcgcgccgaacggtatatttgcggccgggttttacgatggcagtgtgcgcatattc
gatcgccgctgtccgccagccgagacgcgctgcgcaaccatacgggagcacattaacccg
gtgctggcgatctgcctgcgcgacgattgcgaatcgctagtgaccgccgatgtgtcggct
agcgtacggctctacgatataaggaaagcgtactcctccgtacagaactggagcgccggg
acggacgtgtcggcgatggcgatacacacgagcgccgacattctcgcctgtgcaaccagc
cagatcgtcatctacgggctggacggtgtggtgcttagctcgggccgcagcaacgaagga
ttcatggcaccccggaagggtgtggcctcctgtctgtcgtttcataaatacaaactcaat
ctggcggccggctacaacgacaataccgcggcggtgctagtgccatag

DBGET integrated database retrieval system