KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010056Help
Entry
AgaP_AGAP010056   CDS       T01036                                 

Definition
(RefSeq) AGAP010056-PA
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00511  Other glycan degradation
aga00520  Amino sugar and nucleotide sugar metabolism
aga00531  Glycosaminoglycan degradation
aga00603  Glycosphingolipid biosynthesis - globo and isoglobo series
aga00604  Glycosphingolipid biosynthesis - ganglio series
aga01100  Metabolic pathways
aga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AgaP_AGAP010056
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AgaP_AGAP010056
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    AgaP_AGAP010056
   00604 Glycosphingolipid biosynthesis - ganglio series
    AgaP_AGAP010056
   00511 Other glycan degradation
    AgaP_AGAP010056
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AgaP_AGAP010056
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AgaP_AGAP010056
Chaperones and folding catalysts [BR:aga03110]
 Intramolecular chaperones
  Others
   AgaP_AGAP010056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 GHL6 YozE_SAM_like Cep57_CLD
Motif
Other DBs
NCBI-GeneID: 1279486
NCBI-ProteinID: XP_319210
VectorBase: AGAP010056
UniProt: Q7Q0Z2
Position
3R
AA seq 554 aa AA seqDB search
MKAVRWVRVSLALCIHIAYDPLDRGATSSIPGPVVKATKGEIWPKPRNQTTSQQYYTIKT
GSFAFQSMNYSCDLLEKALERYQKLVLSIGNTTRRAMHNRGYAFQSRNELSSASHANRSW
RSDTNWAGYLEQVQVDLKAPCEELPHLSMDEEYTINIDDFQARLSSFSIWGMLRALESFS
QMVVLSDDGSMLRINSTTIDDGPRFSHRGLLVDTSRHFIDTCTLVKILDGMAYNKLNVFH
WHIVDDHSFPYESKAFPELSEKGAYHPSMVYTQRDIQMIIEEARLRGIRVMSEFDTPGHT
RSWGVSHPELLTECQDQYRGKLGPMDPTRESTYTFLSNLFREVIEVFPDQYVHLGGDEVG
FECWASNPNILEYMKQNRLYSFEMLEEKFIQRIVDQIDVLNRSSLVWQEVYVNGVRLPKG
TVVHVWTGNRQDLLNKITRDGLPALLSSCWYLDHLSTGGDWRKFYNCDPHDFIGTGQQKS
LVLGGEACMWSEVVNGHNILPRIFPRVSATAEKLWSPASVNNADEAARRLEEQTCRMNHR
GIPAQPPNGPGFCI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtacgctgggttcgtgtttcgcttgccctgtgcatccacattgcttacgat
cccttggacaggggggctacatcgtcgatcccgggcccagtcgtgaaggctaccaaaggt
gaaatatggcccaaaccgcggaaccaaactacgtcacaacaatactacaccatcaaaacg
ggatcatttgcatttcagtctatgaactacagctgtgatttgttggaaaaagctcttgag
cggtatcaaaaattggttttatccatcggtaacactacccgacgcgcgatgcacaacaga
ggctatgctttccaatcgcgcaatgaactgagctccgctagtcacgccaaccgttcgtgg
cgctcggatacaaactgggccggctatctagagcaggtgcaggtggacttgaaggcaccg
tgcgaggaactgccccatctttccatggatgaagaatatacgatcaacattgatgacttt
caagcgcgtttatcttccttctccatctgggggatgctccgtgcactggaatcgttctcc
caaatggtcgtgctatctgacgatggcagcatgctgcgcataaactccacgacaatcgat
gatggtcctcgtttttcccaccgtggcttactggtcgacacttcgcgccactttatcgac
acctgcacgttggtgaaaatcctcgatggaatggcctacaacaagctgaatgtattccat
tggcacatcgttgacgatcacagcttcccgtacgaaagtaaagcgttccccgagctaagt
gagaagggtgcgtaccacccatcgatggtgtacacccagcgcgacattcaaatgatcatt
gaggaggcaaggctgcgaggcatccgcgtgatgtcggagttcgatacgcccggacataca
cgatcgtggggtgtttcgcatccggaactgttgaccgaatgccaggatcagtatcgtgga
aagctaggaccgatggatccaacgcgtgaatctacctacacctttctgtcgaatctgttc
cgcgaggtgatcgaggtgttccctgatcagtacgtccaccttggcggggacgaggttggg
ttcgagtgctgggctagcaatcccaacatactggagtacatgaaacagaaccggttgtat
tcgttcgagatgctggaagaaaagtttatccagcgcattgtcgatcagatcgatgtgctc
aaccgaagctcgctagtgtggcaagaggtttacgtaaacggtgttcgactaccgaaaggt
acggtggttcacgtttggacgggcaatcggcaggatctgctgaacaagatcactcgcgat
ggtttacctgcactgctgtcctcctgctggtatctggatcatctcagcaccggtggtgat
tggcgcaagttctacaactgcgatccacacgattttatcggaacgggccagcagaaatcg
ctcgtactaggtggtgaagcttgcatgtggtccgaggtggtaaatgggcacaacatactg
ccccgcatttttccccgtgtttctgcgacggctgaaaagctttggtcaccggcaagtgtt
aacaatgcggatgaagcggcccggcgactggaggagcagacgtgccggatgaatcatcgc
ggcatacctgcacagccacccaatgggccagggttctgtatttga

DBGET integrated database retrieval system