KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP010156
Entry
AgaP_AGAP010156   CDS       T01036                                 
Name
(RefSeq) AGAP010156-PA
  KO
K01648  ATP citrate (pro-S)-lyase [EC:2.3.3.8]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00020  Citrate cycle (TCA cycle)
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP010156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP010156
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     AgaP_AGAP010156
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP010156
  Exosomal proteins of bladder cancer cells
   AgaP_AGAP010156
  Exosomal proteins of melanoma cells
   AgaP_AGAP010156
SSDB
Motif
Pfam: Citrate_bind Citrate_synt Ligase_CoA ATP-grasp_2 CoA_binding Succ_CoA_lig
Other DBs
NCBI-GeneID: 1279572
NCBI-ProteinID: XP_319323
VectorBase: AGAP010156
UniProt: Q7Q0U7
Position
3R
AA seq 1082 aa
MSAKAIREATGKDIINRQLQGDHGAAKCRFATVTETTQWQQLVQDNPWLETSPLVVKPDQ
LIKRRGKLGLIAVNKNLAQVKTWVNERMGKDQKIGNATGKLRNFIIEPFVPHKDNEEAYV
CIYSHRTADTILFYHQGGVDIGDVDAKALKLEVPVGTDVTMAEIEKVLLTEISSAKKKRV
ANFVYNLYKMYVDLYFTYLEINPLVVTDDSIYILDLAAKVDATADFICRPKWGEIDYPPP
FGRDAFPEEAYIADLDAKSGASLKLTILNRNGRIWTMVAGGGASVIYSDTICDLGGASEL
ANYGEYSGAPSEQQTYEYAKTILSLMTSSPKHPDGKVLITGGGIANFTNVAATFSGIITA
LRDYQQKLIEHNVSIFVRRAGPNYQEGLRKMREIGSSLGIPLYVFGPETHMTAICGMALG
KKPIAKSNNVHFATANFLLPGGQQGAESSGVSKKITSPATSPVGEAGAARSSPTEIGSNA
YRQMFSNRTKAIVWGMQTRAVHRDEPSVVAMVYPFTGYHRQKFYWGHKEVLIPVYSKMSE
AINKHKEADVLVNFASLRSAYDSSVEVLDYPQIRTIAIIAEGIPENLTRKLNMAARERNV
AIIGPATVGGVKPGCFKIGNTGGMLDNIIHSKLYRAGSVAYVSRSGGMSNELNNILSLTT
DGVYEGVAIGGDRYPGTTFMDHIMRYQADPAAKMIVLLGEVGGVEEYEVCEALKDGRITK
PLIAWCIGTCAGMFTSEVQFGHAGSCANSDRETASAKNKALAEAGAHVPASFDAFGDMIG
SVYESMVKEGLIVPAEEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQELLYAGMP
ISDVLQKNVGIGGVVSLLWFQRCLPPYVCKFFEMCLMVTADHGPAVSGAHNTIVCARAGK
DLVSSVVSGLLTIGDRFGGALDGAAKQFSEAYDSNLHPMEFVNSMRKKGQLIMGIGHRVK
SINNPDVRVKIIKEFVMQNFPAYPLLEYALEVEKITTSKKPNLILNVDGVIATSFVDMLR
NCGSFTSEEAQEYINIGAINSLFVLGRSIGFIGHYMDQKRLKQGLYRHPWDDISYVLPEQ
YN
NT seq 3249 nt   +upstreamnt  +downstreamnt
atgtccgccaaagcaatacgcgaagccaccggtaaagacattatcaaccgtcagctgcag
ggcgatcatggagcggccaagtgtcggtttgcaaccgtgaccgaaactacacaatggcag
cagttggtgcaggacaacccgtggctggagacatcgcctcttgtggttaagcctgatcaa
ctgatcaagcgacgtggaaagcttggactgattgccgtgaacaaaaatctagcacaagta
aaaacatgggtcaacgaacggatgggcaaggatcaaaagattggaaatgctactggcaag
ctgcgcaattttatcattgagcccttcgtaccccacaaggataatgaggaagcgtacgta
tgcatctactctcatcggacggcagacacaattctgttttatcaccagggcggagttgat
atcggcgatgtggacgcgaaagcattgaaattggaagtaccagtcggtactgatgtcaca
atggccgagatcgaaaaagtgttgctgaccgagatttcttccgctaagaaaaagagagtt
gcaaactttgtgtacaatttgtacaaaatgtacgtggatctgtactttacttacttggag
attaatccgctggtcgtgacggacgactccatctacatccttgatcttgccgctaaggtt
gatgcaactgcagatttcatctgtcggccgaaatggggagagatcgattatccgccaccg
tttggacgtgatgcgttcccggaggaagcgtacattgccgatttggatgctaagagtggc
gcttcgctgaagctaaccattctcaatcgcaacggtcgcatctggacgatggtggctggt
ggtggtgctagcgttatctattctgacacaatctgcgacctgggaggcgctagcgagctg
gccaactacggcgaatacagtggcgctccgtcagagcagcaaacttacgagtacgctaag
accattcttagtctaatgacgagcagcccgaagcatccggacggaaaggtgctgatcacc
ggaggtggcattgctaactttacgaatgtggcagcaacgtttagcggaatcattaccgct
ttgcgtgactaccagcagaagctgatcgagcataatgtgtccattttcgtgcgccgtgct
ggtccgaactatcaggagggcttgcgcaagatgcgtgagatcggtagcagcttgggcatt
ccactgtatgtgttcggtccggaaacgcatatgacggctatttgcggtatggcgctggga
aagaaaccgatcgcaaagagcaataatgtacactttgctaccgcaaattttctactgccg
ggcggccagcagggtgctgagtctagtggcgttagcaagaaaattacctcacccgctact
tccccggtaggcgaagctggtgcagcccgcagctctccaacggagatcgggtcgaatgcg
taccgtcagatgtttagcaatcgtactaaggcgatcgtttggggcatgcaaacccgtgcg
gttcatcgcgatgaaccttccgtagtggctatggtgtacccgttcaccggataccataga
cagaagttctactggggtcacaaggaagtgctgattccggtgtattccaagatgtcggaa
gcaatcaacaagcacaaggaagcggacgtgctggtaaactttgcatcgctccggtcggcc
tacgacagctcggtcgaggtgctggactatccgcagatccgcacgattgccatcattgcc
gagggtattccggagaatcttactcgcaagctgaacatggctgcccgtgaacgaaacgtt
gcaatcatcggtccggccacggtcggtggcgtcaagccgggatgtttcaagatcggcaac
acgggcggtatgctcgacaacatcatacattccaagctgtatcgcgctggcagtgttgcg
tacgtgtctcgctcgggcggtatgtcgaacgagctgaacaacattctttcgctgacgacg
gacggagtttacgaaggtgtggcaatcgggggcgaccgttatccgggcactaccttcatg
gatcacatcatgcgataccaggcagatccggctgccaagatgatcgtactgctgggagag
gttggcggtgtggaggagtacgaagtgtgcgaagcgctgaaggacggtcgcatcaccaag
ccgctgattgcctggtgcattggaacgtgtgcgggaatgttcacctctgaggtgcagttc
gggcatgcgggatcttgcgccaactcggaccgcgaaacagcatcggctaaaaacaaggct
cttgccgaagccggcgctcatgtgcctgcatcgttcgatgctttcggtgatatgattgga
tccgtgtacgagagcatggtgaaggagggacttattgtacctgcggaggaagtaccgccc
ccgaccgtaccgatggattactcgtgggctcgcgagcttggtttgatccgtaagccggcc
tcgttcatgacgtccatctgtgacgagagagggcaggaactgctttacgccggtatgccg
atcagcgacgtgctgcaaaagaacgtaggaatcggtggcgttgtgtcgctgctttggttc
cagcgctgtctgccaccgtatgtgtgcaaattcttcgaaatgtgcttgatggtcacggct
gaccatggaccagccgtgtccggtgcacacaacacgatcgtgtgtgcacgagctggcaag
gatttggtgtcatctgtagtgagcggtttgctcacgatcggtgatcggttcggtggtgcg
cttgatggtgcagccaagcaattctccgaagcatacgattccaatctccatccgatggag
tttgtaaactctatgcgcaagaagggtcaactgatcatgggtattggtcatcgagtgaaa
tcgatcaacaatccggatgttcgagtaaagatcatcaaagagtttgtaatgcaaaacttc
ccagcttacccgctgctggaatacgcgcttgaggtggagaaaattaccaccagcaagaaa
ccgaatctaattttgaacgtcgatggagtcattgcaacatcctttgtcgatatgctaagg
aactgcggttcattcacaagcgaggaagcccaggaatacatcaacatcggtgcgattaat
tccttgttcgtgttgggtcgcagcatcggtttcatcggacattacatggatcagaagcgc
ttgaagcagggtctctaccgtcatccatgggacgacatttcgtacgttctacctgagcag
tacaactaa

DBGET integrated database retrieval system