KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010164Help
Entry
AgaP_AGAP010164   CDS       T01036                                 

Definition
(RefSeq) AGAP010164-PA
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00071  Fatty acid degradation
aga01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AgaP_AGAP010164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aga03029]
    AgaP_AGAP010164
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     AgaP_AGAP010164
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    AgaP_AGAP010164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 1279583
NCBI-ProteinID: XP_319335
VectorBase: AGAP010164
UniProt: Q7Q0U0
Position
3R
AA seq 788 aa AA seqDB search
MAEAHSAVAFSFSITHEGWDINYDREVLDLVWQSGVRSWKKRLARFRTGVRNGVYPAHLQ
SLWLVIAIAVGLHFTQRHVPFDLVNKWLSVLPGDSLQWQLTACSLAGLIVWLSICYTMRY
SLKLLLMYKGWMYEKRAPGSRVSLQTRLWGLFVKVLATWNKPGLYSFQGSLPRLPLPSVQ
DTMQRYLRSVRPLLDDSNYNRMERLAKEFEQGISTKLQRYLFLKSWWSTNYVSDWWEEYV
YLRGRGALMVNSNFYGIDAIFMHPTKVQSARAASVVNLLLQFRRTVERQELEPILVQGLV
PLCSWQYERIFNTVRAPGVETDKIIHYQDSNHIVVLYRGCYYKVIIYHNGRLLRPCELQI
QIEHILQQSEEKPQPGEELLASLTAGDRTKWAQIRQTVFAKGVNRTSLHTVESAAFVLSL
DEKPFEFDLAHPEKLDQFGRYLLHGNGHDRWFDKSFTVCVGSNGRIGFNAEHTWADAPVM
AHVWENIVADEATNKRYDENGNTVGIPEFEPPTPKRLTWDLNDKVALVAIDEAHIAAQKL
LNDVDLRILVHDAYGKGLMKTCRLSPDAFIQMALQLAYYRDAGKFSLTYEASMTRLFREG
RTETVRPCTIESAAWVKAMLDSNVSTVDRVRLLNEACERHQLGYQDAMCGKGIDRHLFCL
YVVSKYLEIDSPFLQEVLSEPWRLSTSQTPHGQTAKMDLKKHPNCISAGGGFGPVADDGY
GVSYIVAGEDLIFFHISSKRSCGTTSSERFAQEICRALADMKHLFEEYRSLQKKNPSNGT
NSDKPQAK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcacattcagctgttgcattctcgttctcaatcactcacgaaggatgggac
attaactatgatcgcgaggtgctggacctcgtctggcagtcgggtgtgcgatcgtggaag
aaacggttggctcgattccggactggggtacgcaacggcgtctatccggcccatctacaa
agcctgtggctggtgatagcgatagcggtggggttacattttacacaacggcacgtacca
ttcgacctagtgaacaaatggctatcagttttaccaggcgattcattgcaatggcagctg
acggcatgctcactagctgggttaattgtttggctatcgatttgctacacgatgcgatac
tcactgaaactgttgctcatgtacaagggatggatgtacgagaagcgtgccccaggcagt
agagtttccttgcagactcgcctatggggattgttcgtgaaagtgcttgccacctggaat
aagcccggtctgtacagcttccaaggatcgcttccgaggctaccgttgccaagtgtgcaa
gatacgatgcagcgctatctgcgctcggttcgacctctgctagacgattccaactacaat
cgtatggagcgactagcgaaagaatttgagcaaggcatctcgaccaaactgcagcgatat
ctgttcctcaagagctggtggtcgaccaactacgtgtcggattggtgggaagagtacgtc
tacctgcgaggccgtggcgcactaatggtgaacagcaacttctacggtatcgatgcgatc
ttcatgcacccgaccaaggtccagagtgctagagccgccagtgtggtaaacctgttgcta
cagttccgccgcactgtcgaacgccaagagctggaaccgatcctagttcaaggtttggtg
ccgctgtgttcgtggcagtatgaacgcatcttcaacaccgtacgtgcccctggcgtagag
accgataagatcattcactatcaggactcgaatcacatcgtcgtactgtaccgtggctgt
tattacaaagttatcatctatcacaatggccgtctgctgcgcccgtgtgaactgcaaatt
cagatcgaacacattttgcagcaaagcgaagaaaaaccacaaccaggcgaagagctgctg
gcttcgctgaccgctggagatcgcaccaagtgggcacagatacggcaaaccgtgttcgcg
aagggagtgaaccgcacatcgctgcataccgtcgaaagtgctgcattcgtgctatctctc
gatgagaaaccattcgagttcgatctagctcacccggaaaagttggaccagttcggacgc
tatctgctacacggtaatggacacgatcgctggttcgacaaaagttttaccgtgtgcgta
ggaagcaatggaaggatcggattcaacgctgaacatacgtgggctgatgcacctgttatg
gcacatgtttgggaaaatattgtcgctgacgaggcaaccaataaacgatatgatgaaaat
ggcaacacagtcggcattcctgagtttgagcctccaactcccaaacgattgacatgggat
ctgaatgataaagtagcgctggtcgctatcgacgaggcacacattgccgctcagaagctg
ctgaatgatgtggatctaaggattctggtacatgatgcttacggcaagggattgatgaag
acctgccgcctttccccggatgccttcatacaaatggcgctacagctggcatactacagg
gacgctgggaaattctccctcacctacgaagcatcgatgacccggctgttccgcgaaggt
cgcacagaaacagttcgtccatgcacgattgaatcagctgcctgggtgaaagcaatgctc
gacagcaatgtttcgaccgtagatcgtgttcgtttgttgaatgaagcctgcgagcggcat
cagcttggctaccaagatgcaatgtgcggcaaaggtatcgatcggcatctattctgtctg
tacgtggtgtccaagtatttggagatcgattcacctttcctgcaggaagtgttgagtgag
ccgtggagattatctactagtcaaacgccgcacggacaaacggccaagatggacctgaag
aagcatccgaattgtatcagtgcgggtggcggctttggtcccgtcgcagacgatgggtac
ggtgtgtcgtatattgtggctggagaggatcttatcttcttccacatctcgtcgaaaaga
tcgtgtggaacaacgagttccgaaaggttcgcgcaggaaatttgtcgcgcattggctgat
atgaaacacctgtttgaggagtaccgtagtttacagaagaaaaatccctccaacggcacc
aactccgataaaccacaggcaaagtag

DBGET integrated database retrieval system