KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP010165
Entry
AgaP_AGAP010165   CDS       T01036                                 
Name
(RefSeq) AGAP010165-PA
  KO
K10417  dynein cytoplasmic 2 light intermediate chain
Organism
aga  Anopheles gambiae (malaria mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aga03036]
    AgaP_AGAP010165
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:aga03037]
    AgaP_AGAP010165
   04812 Cytoskeleton proteins [BR:aga04812]
    AgaP_AGAP010165
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      AgaP_AGAP010165
Cilium and associated proteins [BR:aga03037]
 Primary cilia and associated proteins
  Dynein and associated proteins
   AgaP_AGAP010165
Cytoskeleton proteins [BR:aga04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     AgaP_AGAP010165
SSDB
Motif
Pfam: DLIC RsgA_GTPase Roc AAA_16 Ras AAA_22 Septin MMR_HSR1 ATPase_2 AAA_29 TniB AAA_7 ABC_tran
Other DBs
NCBI-GeneID: 1279584
NCBI-ProteinID: XP_319337
VectorBase: AGAP010165
UniProt: Q7Q0T9
Position
3R
AA seq 339 aa
MEVDTTETIQDIAIKLVTEQLRNESRLATTPTERTLFVLGSKGVGKSTLINRFLDRDDVP
RPTLALEYSFGRKTASGQGAQKNICNVWELGSLANSSQLIEMPIRSHGLQTFSCIVMLDL
SQPDRLWTDLESVLNGLKQATAKHAVAGQIEEMKELTAQRIGKEHPDLSTLELFPFPIVI
VGGKYDIYQNQDSEIRKHVCRCLRSIAHTLGAALVYYSAKNSSLSKLVRDTMNHLGFGSP
SNPFRAASFDHSSPLAIPFGADSWARIGVTPSNSERIGLSFSTQIPQLPIGNGGILPDDP
AKDAGFKEASIDELRSQKDEELMYVLKDTEIRMKFEVVQ
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaagttgatactacagaaacaatacaggacattgccatcaagctggtgacggagcag
ctgaggaatgagtcgcggctagctactacccctacggaacgtacactcttcgtgctcggc
agcaaaggagtgggcaaatcgacattaattaatagattcctcgatcgagatgacgtgcca
agaccaacgctagcactggagtactcgtttggccgcaaaacggcttcgggacagggtgcg
cagaaaaatatatgcaacgtgtgggagctgggcagtttggcaaactcgagccagctaatt
gagatgcccatccggtcgcacgggttgcagacgttctcgtgcattgtcatgctcgatctt
tcgcaaccggatcgtctctggacagatctcgaaagtgtgctgaatgggttaaagcaggcc
acggcaaagcacgccgtcgctgggcagatcgaagagatgaaagaactgacggcccagcgg
atcggtaaagagcatcccgatttaagcacgttagagctgtttccctttccaattgttatt
gtgggcggcaagtacgacatttaccaaaaccaagactcagaaatacgcaaacacgtgtgt
cgctgtttgcgctccatcgcccacacgctgggcgctgcgttagtgtattactcggcaaaa
aactcgtccctctccaagctcgtacgggatacgatgaaccatttaggtttcggaagtcct
tcaaatccctttcgggcggcgtcatttgatcattcgtccccactggccataccattcggt
gccgactcttgggcacgcatcggcgtaacgccaagcaattcggagcgtatagggctcagc
ttcagtacgcaaatcccccagctgccgataggaaatggaggcattctgccggacgatcca
gcaaaggacgccggatttaaggaagcttcgatcgacgaactgcgctcacagaaggacgaa
gagctgatgtatgtgctgaaggataccgaaattcgaatgaagtttgaagtggttcagtaa

DBGET integrated database retrieval system