KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP010198
Entry
AgaP_AGAP010198   CDS       T01036                                 
Name
(RefSeq) AGAP010198-PA
  KO
K10807  ribonucleoside-diphosphate reductase subunit M1 [EC:1.17.4.1]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00230  Purine metabolism
aga00240  Pyrimidine metabolism
aga00480  Glutathione metabolism
aga00983  Drug metabolism - other enzymes
aga01100  Metabolic pathways
aga01232  Nucleotide metabolism
Module
aga_M00053  Pyrimidine deoxyribonucleotide biosynthesis, CDP => dCTP
aga_M00938  Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP010198
   00240 Pyrimidine metabolism
    AgaP_AGAP010198
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AgaP_AGAP010198
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    AgaP_AGAP010198
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aga03400]
    AgaP_AGAP010198
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     AgaP_AGAP010198
DNA repair and recombination proteins [BR:aga03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    AgaP_AGAP010198
SSDB
Motif
Pfam: Ribonuc_red_lgC Ribonuc_red_lgN ATP-cone
Other DBs
NCBI-GeneID: 1279619
NCBI-ProteinID: XP_554103
VectorBase: AGAP010198
UniProt: Q5TNU6
Position
3R
AA seq 809 aa
LKMVLKPNKMYVFKRDGRKEEVHLDKITSRIQKLCYGLNMDFVDPVAITLRVINGLYSGV
TTQELDNLAAETAATLTTDHADYAILAARLAVSNLHKETKKQFSEVMHDLYMMENEFLKT
KSPMISDFHYKVIMDNADRLNSAIIYDRDFGYNYFGFKTLERSYLLKIKGKIVERPQHML
MRVAIGIHGEDIDAAIETYNLLSERYFTHASPTMFAAATQRPQLSSCFLLTMSEDSIEGI
YDTLKQCALISKSAGGIGLNVHCIRAKGTYISGTNGISNGLVPMLRVYNNTARYVDQGGN
KRPGAFAIYLEPWHGDIFEFLDLKKNTGKEEVRARDMFYALWIPDLFMQRVEANEMWSLM
CPHDCPGLSDTWGEEFEKLYTGYEKEGRFIRQVKAQDLWFAIIESQVETGVPYMLYKDAC
NRKSNQQNIGTIKCSNLCTEIVEYSSKDEVAVCNLASIALNMFVKQDKTYDFAKLKEVAK
TVTRNLNKIIDVNYYPVPEAKRSNMRHRPIGIGVQGMADAFILMRYPYESEEAQKLNQQI
FETIYYGALEASCELAARDGPYETYEGSPVSKGILQYEMWNKEPTDLWNWAELKEKIAKH
GIRNSLLLAPMPTASTAQILGNNESFEPYTSNVYNRRVLSGEFQVVNHHLLQDLTNMGLW
DLDMKNEILSNNGSIQKIAAIPQEIRDLYKTVWEISVKTCIKMAADRGAFIDQSQSFNIH
VAEPNYGKLTSIHFYGWKMGLKTGMYYLRTKPAVNAIQFTVDKTKLQNGNESNVSRMSNE
NGSFAERNRRMAEMVCSLENKDECMMCGS
NT seq 2430 nt   +upstreamnt  +downstreamnt
ctcaagatggttctaaagccaaacaagatgtatgtcttcaagcgtgatggccggaaggag
gaagtgcatctggacaaaatcacgtcaaggatacagaaactttgctatgggctgaacatg
gatttcgtcgatccggttgctataacattgcgtgtaatcaatgggctctactcaggtgta
acgacgcaggagcttgacaatctagccgccgaaacggcagccaccctaacgactgatcat
gccgactacgcgattttggctgctcggctggccgtttccaacctgcacaaggaaacgaag
aaacaattttctgaggttatgcatgatctgtacatgatggagaacgagtttctgaaaacg
aaatctcccatgatctcggactttcattacaaggtgataatggataacgccgaccggctg
aactcggccatcatttacgatcgcgacttcgggtacaactatttcggctttaaaaccttg
gaacgatcatacttgctgaagatcaagggaaaaatcgtcgagcgcccccagcacatgctg
atgcgcgttgctattggcatccatggcgaggacatcgatgcagcaatcgagacctacaat
ctgctgtccgagcgttactttacccacgcctcaccaactatgtttgcggcggccacgcag
cgtccccagctttcgtcctgcttcctgttgaccatgtccgaagatagcattgagggcatc
tacgacacgctgaagcagtgtgccctaatttcaaagtcggccggtggcatcggactgaac
gtgcactgtatccgcgcgaagggaacgtacatctccggtacgaacgggatttcgaacggt
ctggtgccgatgctgcgcgtctacaacaatacggcacggtacgtcgatcagggtggtaac
aagcggcctggagcattcgctatctatctcgagccgtggcatggcgatatattcgagttt
ctcgatctgaagaaaaacaccggcaaggaggaggtccgcgcacgggacatgttttacgca
ctctggataccggacctgtttatgcagcgtgtggaggcgaacgaaatgtggagcctgatg
tgcccgcacgattgtcccggtctatcggacacctggggcgaagagttcgagaagctgtac
accgggtacgaaaaagagggtcgctttatacggcaggtgaaggcgcaggatctgtggttt
gcgatcatcgaatcgcaggtggaaaccggcgtaccgtacatgctgtacaaggatgcttgc
aatcgtaaaagtaaccagcagaatatcggcaccatcaaatgttccaacttgtgcactgag
attgtggagtactcgtcgaaggatgaggtagcggtatgcaatctggcctcgatcgccttg
aacatgtttgtaaagcaagacaaaacgtatgactttgcaaagctgaaggaagtcgctaag
accgtaacgcgcaatctgaacaaaatcattgatgtcaattactatcccgtgccggaggct
aagcgctccaatatgcgccacaggccgatcgggatcggcgtgcagggcatggccgatgcg
ttcatcctgatgcgctatccgtacgaaagcgaagaggctcaaaagctaaatcagcaaata
ttcgaaaccatctactacggcgcgctggaagcgagctgtgagttggccgctcgagatgga
ccgtacgagacgtacgagggcagtccggtgagcaagggcatcttgcagtacgagatgtgg
aacaaggaaccgacggatctgtggaactgggccgagttgaaggaaaagatcgccaagcac
ggtattcgcaattcgctgctgttggccccgatgccgacggcttccacggcacaaattctc
ggcaacaatgaatcgttcgagccgtacacgtcgaacgtttacaataggcgcgtgctgtcg
ggcgagttccaggtggtgaaccatcatcttctgcaggatttgaccaacatgggtctgtgg
gatctcgacatgaagaacgaaattctgtccaacaatggatcgatccaaaagattgcggct
ataccgcaggaaattcgcgacctgtacaaaacggtatgggagatctcggtgaaaacgtgc
atcaaaatggccgcagatcgtggcgcgtttatcgatcagtcgcaatcgttcaacattcac
gtcgcggagccaaactatggcaagctgacgtcgatccatttctacggctggaagatgggg
ttgaaaactggcatgtactatctacgtaccaagccggccgtaaatgcgatccagtttacg
gtggacaagacgaagctgcaaaacggtaacgagtcgaacgtcagtcgcatgtcgaatgag
aatggttcatttgcggaaagaaaccgtagaatggcggagatggtatgctcgctggaaaac
aaagacgagtgcatgatgtgtggatcgtag

DBGET integrated database retrieval system