KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010282
Entry
AgaP_AGAP010282   CDS       T01036                                 

Definition
(RefSeq) AGAP010282-PA
  KO
K08735  DNA mismatch repair protein MSH2
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    AgaP_AGAP010282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aga03400]
    AgaP_AGAP010282
DNA repair and recombination proteins [BR:aga03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     AgaP_AGAP010282
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II
Other DBs
NCBI-GeneID: 1279706
NCBI-ProteinID: XP_319476
VectorBase: AGAP010282
UniProt: Q7Q0L2
Position
3R
AA seq 881 aa
MSTLKPLHCLNLDKAQQRTFIEFYKSLGEKPATTVRIFDRTDYYSCHGVDAAFVAKTLFK
SSNAIKIMEVDNQQLPYVSLSKNNFEGLIRDLLLVRNYRIEVYSKESKRKHENDWSIQYK
GSPGNLAHFEDVLFNNNNEMVIGSALIALHIRHESKQRMIGLGFIEVNERRMAVIEFVDD
DFYTELEALIVVTGPKECLLPSVAAEYERVEQIMKRNNVIVTTRKVKEFMKDKVDVIDSL
NKLLRFREGQHPNANTIPEVSKSLALSALGVILNYLELTQEPGNHGQFRLESLDANRFVH
LDAAAVSALNLFPNPGTSVKSNAYRWQSVLGVLDRCRTPQGHRLMAQWMKQPLQDYEIIK
DRHDIVEYFVNNTIVRSELYDNHLKKLPDIMFVLKRLLRRKASLQDIFRLYQVILRVPRM
LTLLETNDLESIAVLNNIYNPIKDSLNDLKLFKSMVEQIIDLQAVEHGEYLVKADFDSQL
KKRKEEMDEVYSKMKHHLSTVAKDIGLDAGSSIKLEFVSQHGYHFRITLKDETLIRKNNS
YRILDAVKGGVRFITTKLQDYSESFATLKIAYEEQQQTIVAEVIRVAVGYVEPWTMLNSQ
IAYLDCLVSFAVSASTAPIPYVRPKMYREGPSVLKLIQVRHPCLELQEDVNYIANDAMFD
AKETSTYIITGPNMGGKSTYIRSVGVTVLMAHIGSFVPCESAEMSIFDCILGRVGADDNF
TKGLSTFMVEMIETAGIIRRATDRSLVIIDELGRGTSTYEGCGIAWSIAEWLAKESKCFT
LFATHFQEITDLASYVENVKNCHMQAIVDGECLTLLYQVKPGVMEKSFGIQVAKLANFPP
GVIKLAQKFYNECEDHRGVIKEKHDTDCLAVLQKCFSEIDN
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgtcgaccttgaaaccactacattgtctaaatctagacaaagcacagcagcgaacattc
atcgagttttataagtcattaggcgagaaaccggctactactgtgcgaattttcgatcga
acggattattacagctgccatggcgttgatgccgcatttgttgccaaaacactttttaag
tcttcgaacgcgatcaaaattatggaagtagataatcagcagttgccgtatgtttccttg
agtaaaaacaatttcgagggacttattcgagacctactgctcgtgcgtaactatcgaata
gaagtgtattcgaaggaatcgaaaaggaaacatgagaatgattggtcgatccagtataaa
ggatcaccagggaatttggcacacttcgaagatgttttgtttaacaacaataacgaaatg
gttatcggttcggctctgattgctctgcacattcgtcatgaatccaagcaacgaatgatt
ggtttaggatttatcgaagtaaatgagagacgtatggccgtgattgaatttgtcgacgat
gatttctacactgagctggaggctttaattgtagttacgggacctaaagagtgtctactt
cccagtgtcgcagcagagtacgaacgtgtcgagcaaattatgaagcgtaataatgtgatc
gttacaacacgcaaggtgaaagaatttatgaaggataaagtcgatgtcatcgacagtttg
aacaaactgctgcggttccgcgagggacagcatccaaatgcaaacaccattccagaagta
tctaaatcgctggctctaagtgcactgggtgtaatcttaaactatctcgagcttactcaa
gaaccaggcaaccatggtcagtttcgtctggaatcgctcgatgcaaaccgctttgttcat
cttgatgcagctgcagtatcggctttgaatctttttccaaacccaggcacgtcagttaaa
tcgaacgcctatcgatggcaaagtgttctgggcgtacttgataggtgtcgcacaccacaa
ggccaccgattgatggcacaatggatgaaacagccgctacaagattatgagattatcaaa
gatcggcacgatattgtggagtattttgtcaacaataccatagtacgctctgagctttat
gataatcatcttaaaaagcttccagatataatgttcgtgctcaagcgtcttttacgcaga
aaagcttcgctgcaggacatttttcgtttgtaccaagttattttacgtgtgccaagaatg
ttaactcttctggaaacgaacgatctagaaagtattgctgtgctgaacaatatatacaat
cctatcaaggatagcttgaatgatttgaagctatttaaatccatggttgaacaaatcatt
gacttgcaagcggtcgaacatggcgaatatcttgtaaaagctgatttcgacagccagcta
aagaagcgaaaagaagaaatggacgaagtttattctaaaatgaagcatcatctatccaca
gtagccaaagacatcggattggatgcgggatcgtctattaagcttgaatttgttagccaa
catggttaccattttagaatcacgcttaaagatgaaactttaatacggaagaacaattcc
tatcgcatcttagatgccgtaaagggtggcgttcggtttatcacaactaaactacaagat
tacagcgagtcttttgctacgttaaaaattgcgtatgaggaacaacagcaaactattgtc
gcagaagtgatacgtgtagctgtaggatatgtagaaccatggacaatgctcaatagtcag
atagcgtacttagactgtctggtaagctttgcagtgagtgcttcaactgcaccgatccca
tacgtacggcccaaaatgtatcgcgaaggtccaagtgtgttaaaactgattcaagtgcgt
catccctgtttggagttgcaagaagatgtcaactatatcgccaacgatgcaatgtttgac
gccaaggaaacttccacttacattatcaccggcccaaatatgggtggcaaaagtacctat
ataagatctgtgggagtcactgtcttaatggctcatatcggctcattcgtaccatgcgag
agtgcagaaatgtcaattttcgattgcatcttggggcgagttggcgccgatgataatttt
accaaaggactcagtacattcatggtggagatgatcgaaactgcaggaataattcgcaga
gcaacagatagatcgcttgtaataatcgacgagcttggacgcggcacatccacatatgag
ggatgcggcattgcgtggtccatcgctgaatggctagcaaaagagagcaaatgttttacc
ttatttgccacccattttcaggaaataaccgaccttgccagctacgtagaaaacgtgaaa
aactgtcacatgcaagccatagttgatggcgaatgtttgactttattgtatcaggtaaaa
ccgggagtaatggagaaaagttttggcatacaagtcgctaagctggctaattttccgcca
ggtgtcataaagctagctcaaaagttctacaatgaatgtgaagatcatcgaggagtcatt
aaagaaaagcatgatactgattgtttggcggtgctgcaaaagtgtttctctgagatcgat
aat

DBGET integrated database retrieval system