KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010395Help
Entry
AgaP_AGAP010395   CDS       T01036                                 

Definition
(RefSeq) AGAP010395-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 3291079
NCBI-ProteinID: XP_559060
VectorBase: AGAP010395
UniProt: Q5TUE4
Position
3L
AA seq 680 aa AA seqDB search
MTSSYERIKSECKQKGVLWEDEDFPATQSSVFYHQTPPFTFQWKRPHEIVSNPVFVNDAS
AQFDIVPGKMGDRWLVSCLGVLYLSKGLFYRVVPADQNFDKPYYGVFRFRLWWCGEWLEV
LVDDRLPTINGKLAFLQAQNTNSFWPGLLEKAYAKLHGSYEALKYGTLLDGLADLTGGIT
ESISIKVESNILIRPPLLHNLLDTTSIITCTINNGTMTQIRNQTEALPNGIHVGINYRLC
SMDKAETIMGDTVQLVRLRNPLAQTLSKSFNFNGDWSSFSNSWERVTMNERNRLIEQLDQ
GEFWMSFFDMTQTFTHLECVHLDSDTARDEPQLADKSRRWLMRLYQGAWKRGVTAGGCRN
NPDSFHINPQLQLFLSEKEDVIISVNQHSVLEPKVIGFTVYNLNSVQNINGCLSKNFFKK
HKSLVNSQYTNSRQISHRCSLDPGRYLIMATTFEPAEEASFSVRVLGSTIRLALLETQTM
LLLDPFPLLNSNTKITIDSTNNNNNNGISCSTAQYEPVFMQLADDQRTLNCFDLQELLEA
CLPNDYIRSCASIDVCRQVVCLMDKTNRGRINFNDFNKFMINLKTWWGVFKMHTKEKSGI
LKAERLRDALFDVGFQLSTDNISILILRYMRRDGTLRLADFISAILHLTMAFELFKAKDT
NQDGIISMGMTEWIKSVFMC
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgtcctatgaacgtatcaaatctgaatgcaagcagaaaggtgttttatgggaa
gacgaagatttccctgcaacgcaatcgtccgtcttttaccatcaaacgccaccgttcacc
ttccaatggaaaagaccacacgagatcgtctcaaatccggtattcgtcaacgatgcgtcc
gcacagttcgatattgtgcctggcaagatgggcgatcgttggcttgtgtcgtgtctgggc
gtactctacctttcaaaagggttgttttatcgagtggtaccggctgatcagaatttcgac
aaaccgtactatggagtgtttcgttttcgactttggtggtgtggcgaatggttagaggtg
ttagttgatgatcgattacccacaataaatggcaagttggccttccttcaagcgcagaac
accaactcgttctggccaggtttgttggagaaagcttatgcaaaattgcatggctcatat
gaagcgttgaagtatggtacactgctggacggattggctgacttaactggtggtatcact
gagtcaatatctatcaaggtagagagtaatatcctcatacgaccaccccttctgcataac
ctattggacacaacgagcatcataacctgcacaatcaacaatggtaccatgacacagatc
cgtaatcaaacagaggctttgccgaacggaatccacgtgggaattaattatcgcttgtgc
tcgatggacaaggccgaaactatcatgggtgacacagttcagctagtacgcctacgaaat
cctttggctcaaacgctcagcaaatcatttaactttaacggcgactggtcatcattttcc
aattcctgggaacgtgtaacaatgaacgaaaggaatcggctcattgagcaactcgatcag
ggtgaattctggatgtcatttttcgatatgacccaaacctttacgcatcttgaatgcgtt
catcttgactcggatacggctagggatgaacctcaattagcagataaaagtcgtcgctgg
ctaatgcgactgtatcagggtgcttggaaacggggagttacggcaggtggatgtcgcaac
aatccggactctttccacatcaatccacagctacaactgtttctcagtgaaaaagaggat
gtcatcatttctgtgaaccagcatagcgtgcttgaaccaaaagtaatcggtttcacagta
tacaatctgaacagcgtgcaaaacatcaacggttgtctttcgaaaaatttcttcaagaag
cacaaaagcttagtcaactctcaatacaccaactcgcgacaaattagtcaccgatgttca
cttgatcctggccgctatcttattatggccaccacattcgagcctgcagaggaagcatca
ttcagtgtcagagttttgggaagtaccattcgattggctcttcttgaaactcaaaccatg
cttttactagatccattcccgctgctcaactctaacaccaagattaccattgattcaaca
aataataacaacaataatggcatctcttgtagtactgcgcagtatgaaccagtttttatg
caacttgcggatgatcaaagaacgctgaattgttttgacctgcaagaattacttgaagcg
tgccttcctaatgattacattcgaagctgtgccagtatagatgtttgtagacaggtggta
tgtttaatggataaaacgaatcgtggtcgtataaattttaacgatttcaacaagtttatg
atcaatctcaaaacttggtggggagtattcaagatgcacacaaaggaaaaatcgggcata
ctgaaggcagaacgattacgagacgcacttttcgatgttggattccagctcagtacggat
aacatttccatccttattttacgatatatgcgaagggatggaacacttcgattagctgac
tttatttcagcaattctgcatctaactatggctttcgagttgttcaaagcaaaggatacg
aatcaagatggaatcattagtatgggaatgactgagtggattaaatctgtttttatgtgc
tag

DBGET integrated database retrieval system