KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010404Help
Entry
AgaP_AGAP010404   CDS       T01036                                 

Gene name
GST_ANOGA
Definition
(RefSeq) AGAP010404-PA
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00480  Glutathione metabolism
aga00590  Arachidonic acid metabolism
aga00980  Metabolism of xenobiotics by cytochrome P450
aga00982  Drug metabolism - cytochrome P450
aga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AgaP_AGAP010404 (GST_ANOGA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AgaP_AGAP010404 (GST_ANOGA)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    AgaP_AGAP010404 (GST_ANOGA)
   00982 Drug metabolism - cytochrome P450
    AgaP_AGAP010404 (GST_ANOGA)
Enzymes [BR:aga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AgaP_AGAP010404 (GST_ANOGA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     AgaP_AGAP010404 (GST_ANOGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_N_3 GST_C_2 GST_N_4 Moulting_cycle
Motif
Other DBs
NCBI-GeneID: 1272645
NCBI-ProteinID: XP_311546
VectorBase: AGAP010404
UniProt: P46428
Position
3L
AA seq 218 aa AA seqDB search
LSSSSISRSSLKCNIMPDYKVYYFNVKALGEPLRFLLSYGNLPFDDVRITREEWPALKPT
MPMGQMPVLEVDGKKVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTVNDFRLKIAIV
AYEPDDMVKEKKMVTLNNEVIPFYLTKLNVIAKENNGHLVLGKPTWADVYFAGILDYLNY
LTKTNLLENFPNLQEVVQKVLDNENVKAYIAKRPITEV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
cttagctcaagttcgatcagcagatcttcacttaagtgcaacatcatgccggattacaag
gtttactatttcaacgtaaaagctctgggcgaaccactgcggttcctgctgtcttacggc
aaccttccgttcgatgatgtgaggatcacccgcgaagaatggccagcactcaagccaaca
atgccgatgggtcagatgccggtactggaggttgacggcaaaaaagtgcaccagtcggtc
gctatgtctcgctatctggccaaccaggtcggtttggccggcgctgatgattgggagaac
ttgatgattgacaccgtggtcgacacggtgaacgatttccgtctaaaaattgcgattgtc
gcctacgaaccggacgatatggtgaaggagaaaaaaatggtcaccctgaacaacgaggtg
attccgttttatctgactaagctgaacgtgatcgccaaggagaacaatggccacctggtg
cttggcaagccgacctgggctgatgtttattttgctggtatcctagactatctaaactac
ctgaccaagacaaatctgctcgagaacttcccgaacttgcaggaggtggtccagaaggtg
ctagataatgagaatgtcaaagcttacattgctaagagacccatcaccgaagtttag

DBGET integrated database retrieval system