KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010513
Entry
AgaP_AGAP010513   CDS       T01036                                 

Gene name
GPRMAC1
Definition
(RefSeq) AGAP010513-PA
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:aga00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    AgaP_AGAP010513 (GPRMAC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aga04030]
    AgaP_AGAP010513 (GPRMAC1)
G protein-coupled receptors [BR:aga04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    AgaP_AGAP010513 (GPRMAC1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srbc 7tm_4 S_4TM YajC
Other DBs
NCBI-GeneID: 1275250
NCBI-ProteinID: XP_314486
VectorBase: AGAP010513
UniProt: Q7Q8W8
Position
3L
AA seq 662 aa
MGGFPFERTTVDSFLSRYTTETSISTATTTVTAVEELFFNVTSSSDSLPTANGTLEVLVE
DPPTYSLAQIIILGIIATVLSILTVAGNVMVMISFKIDKQLQTISNYFLFSLAIADFAIG
LISMPLFSVTTLLGYWPLGPHICDTWLALDYLASNASVLNLLIISFDRYFSVTRPLTYRA
KRTTTRAAIMIGAAWGISLLLWPPWIYSWPYIEGKRTVPEKECYIQFIETNHYITFGTAI
AAFYVPVTVMCFLYYRIWRETKKRQKELKNLTGDRKKDSSKRSNSSDENTAVNHSGGHVL
PASVAEDGWRRPRSESSADAESVYMTNAVLPDGAYGHGMLSRRSSITMNGVPKKPTTFFG
GIKEWCIAWWHSGREDSDDYGYDVEEPSDLGCTSLNVIRDPYVAGSGGRSNVVSMIPDIS
PTPIRPALPPLAHLQDMHGARDSRSLPNSNRLGSRSVSQDSVYTILIRLPPEGGSGDERA
PSIKMIQDDVPMSMTVPPRRPLPSRDSDYILPVATRRQSTATTDFRLPLSAKIISKPLSK
QQQQLHQANLAQTARQVKKKKKSQEKRQETKAAKTLSAILLSFIITWTPYNILVLLKPLT
ACTKCIPQELWDFFYALCYINSTINPVCYALCNASFRRTYVRILTCKWHTRNREAMTRGV
YN
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgggtgggtttccgttcgagcgaacgacggttgacagctttctgtcacgctacacgacg
gagacatcgatatcgaccgcaacgacgacggtcacggccgtggaagagctattcttcaac
gtcacatcgtcatctgactcgctgcccaccgccaatgggacgctggaagtcctggtggag
gatccaccgacctattcgctagctcagatcatcatcctcggcatcatcgcgaccgtactc
agtatcctcaccgtcgctggcaatgtgatggtgatgatctcgtttaaaatcgacaaacag
ctgcaaacgatcagtaactactttttgttctcactcgccattgccgattttgcgatcggg
ctgatctcgatgccattgttctcggtcaccacactgctgggatactggccactgggacca
catatctgtgacacctggctagcgctagactatctggcatcgaatgcttctgtgctaaat
ctgctgatcatcagcttcgatcgctactttagcgtgacgcggccactgacctatcgagcg
aagcgcacgactacaagagcggccataatgatcggtgcagcgtggggcataagcttactg
ctgtggccaccctggatctatagctggccgtacatcgagggcaagcggacagttcccgag
aaagagtgttatattcaattcatcgagaccaatcactacattacgttcggtacggcgatc
gctgcgttttacgtgccagttaccgtgatgtgcttcctttactatcggatatggcgcgaa
acaaagaagcgacagaaagagttgaaaaatctaaccggtgaccggaagaaagattcatcc
aagcggtccaactcaagtgatgaaaacacagcggtcaaccattcaggaggtcacgtattg
cctgctagcgttgccgaggatggctggcgaagacctcgcagtgagtcttcagcggacgcg
gaaagcgtttacatgaccaatgccgtccttccggacggtgcctacggacacggcatgcta
tcccgacgatcaagcatcaccatgaacggagtcccgaaaaagccgaccaccttcttcggc
ggcatcaaagagtggtgcatcgcgtggtggcattccgggcgcgaagactccgacgactac
gggtatgacgtcgaggaaccgtcggacttaggatgcacctcactgaacgtgatccgtgat
ccatatgtggccggcagtggcggtcgtagtaacgttgtcagcatgataccggacatttcg
cccactccgatacgccctgctctgcccccgctggcccatctgcaagacatgcacggtgca
cgggattctcgctcgctaccgaacagcaaccggttaggatcgcggtcagtcagccaggac
tccgtgtacaccatcctcatccgactgccaccggagggtggatcgggtgacgagcgggca
ccctcgatcaagatgatacaggacgacgtaccgatgtcgatgacggtaccaccgagacgt
ccgctaccgtcgcgcgattccgattacattttaccggtagcgacgcggcgccaatcaacc
gcaaccactgacttccggttaccgctctcggcaaagatcatctccaaaccgctgtcgaag
cagcagcagcaactgcaccaggcaaaccttgcccaaaccgcccgccaggtgaagaagaag
aaaaagtcccaggagaagcgccaggaaacgaaggccgccaaaacgctgtcggccatcctg
ctgagcttcatcatcacctggacgccgtacaacatcctggtgctgctgaagccacttacc
gcgtgcaccaagtgtataccgcaggagctgtgggactttttctacgcactttgctacatc
aactcgaccatcaacccagtctgctacgccctctgcaacgcttcgttccggcggacgtac
gtgcgcatccttacctgcaagtggcacacgcgtaaccgggaagcgatgacgcggggtgtc
tataactga

DBGET integrated database retrieval system