KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010792Help
Entry
AgaP_AGAP010792   CDS       T01036                                 

Definition
(RefSeq) AGAP010792-PA
  KO
K03953  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00190  Oxidative phosphorylation
aga01100  Metabolic pathways
Module
aga_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    AgaP_AGAP010792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 NmrA RmlD_sub_bind NAD_binding_4 GDP_Man_Dehyd adh_short
Motif
Other DBs
NCBI-GeneID: 1278870
NCBI-ProteinID: XP_318516
VectorBase: AGAP010792
UniProt: Q7Q229
Position
3L
AA seq 385 aa AA seqDB search
TGLLGIVCLKANYSSDAPRKLKTTSLAAMKRGTGGRSSFNGIVATVFGSTGFLGRYVCNK
LGKIGSQVIIPYRADHYEAMRLKLVGDLGQVLFHPYDLRDEEAIYKAVKYSNVVINLVGR
DWETKNFTFKDVHVDGARRLARIAREAGVETFVHVSSLNATPNPQPFFTKEGSKFLASKY
YGELAVREEFPDAIVFRPSDIYGQEDRFLRYYAHIWRRQFRAMPLWYKGERTIKQPVYCS
DLAQGIVNAIKDSDSQGQTYQAVGPRRYKLSALVDWFHQVMRKDEKWWGYYRYDLRYDPT
FRMKVLLTELVSPSFPIGDVHTERVEREYVSDEVEKGVPTLEDLGVNLTYMEDQVPWELR
PYRAALYYDAELDEFEKPTPPQYIQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
accgggctgctcggtatcgtgtgcctgaaggcgaactacagcagcgatgcaccacgcaag
ctgaagacgaccagcctggcggcgatgaagcgcggcacgggcggccgctcgagcttcaac
ggcatcgtcgcgaccgtgttcggcagcaccgggttcctcgggcgctacgtgtgcaacaag
ctgggcaaaattggcagtcaggtcatcatcccgtaccgggcggatcactacgaggcgatg
cggctgaagctggtcggcgatctcggccaggtgctgttccatccatacgatctgcgcgac
gaggaagcgatctacaaggcggtgaagtactcgaacgtcgtcatcaatctggtcgggcgc
gactgggagacgaagaacttcacgttcaaggatgtgcacgtggacggggcccgtcggttg
gcccgaattgcgcgcgaagccggcgtggagacgtttgtgcacgtgtcgagcctgaacgcg
acgccgaacccgcagccgttcttcaccaaggagggcagcaagttcctggcgagcaagtac
tacggcgagctggcggtgcgggaggagttccccgatgcgatcgtgttccgcccgtcggac
atctacgggcaggaggatcggttcctgcgctactacgcgcacatctggcgccggcagttc
cgcgcgatgccgctgtggtacaagggcgagcgcacgatcaagcagccggtgtactgttcc
gatctggcgcagggtatcgtgaacgcaatcaaggactcggacagccagggccagacgtac
caggcggtggggccgcgccggtacaagctgtccgcgctggtcgactggttccaccaggtg
atgcgcaaggacgagaagtggtggggatactaccggtacgatctgcgctacgatccgacc
ttccgcatgaaggtgctgctgaccgagctggtgtcgccgtcgttcccgatcggcgacgtg
cacacggagcgggtcgagcgggagtacgtgagcgatgaggtggagaagggcgtaccgacg
ctggaagatttgggcgttaatctgacgtacatggaggatcaggttccgtgggaactgaga
ccgtaccgtgccgccctgtactacgacgctgagctggatgagttcgaaaagccaacgcca
ccacagtacatccagtag

DBGET integrated database retrieval system