KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010836
Entry
AgaP_AGAP010836   CDS       T01036                                 

Definition
(RefSeq) AGAP010836-PA
  KO
K06664  peroxin-2
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AgaP_AGAP010836
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aga04121]
    AgaP_AGAP010836
Ubiquitin system [BR:aga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    AgaP_AGAP010836
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4 zf-C3HC4_3 zf-RING_5 zf-RING_UBOX zf-C3HC4_2 Prok-RING_4 zf-C3HC4_4
Other DBs
NCBI-GeneID: 1271126
NCBI-ProteinID: XP_309872
VectorBase: AGAP010836
UniProt: Q7PFH7
Position
3L
AA seq 286 aa
MGSSNQNTGKIKTNFVPRVNQLDSIQLDNEITNLLRQQIQNILQVLPPGLLSHLQPEINF
VLNSALWNFSIRTHYATFGQQMLSIAYEKDQLPSAKLALHYLLTTVLPYAKENAQFRLTN
WSRVQKLLQLAENALVLFNLVNFFKFLRSGTRPSLVDCLLRINHRSLDGAKRRTIGYSYM
TRELVWAGFMELLGFTIPFVNYHALKRKLRNLLRIEAAPQRQDEHVELTVDTRCAYCNER
VILPHHMGCRHVFCYLCLKGNQLADAGFQCNVCDYRSETFRKVVVL
NT seq 861 nt   +upstreamnt  +downstreamnt
atgggcagctccaaccaaaacacgggaaaaattaaaacaaacttcgtacctcgggtgaat
cagctagactccatacagctcgacaatgaaataacaaacctcctccgccagcagatacag
aacatactacaggtcctaccgcccggactgctgagccaccttcagccggagataaatttt
gtcctaaactcagccctttggaacttttccatccgcacacactatgccaccttcggccag
cagatgctgtcgatcgcgtacgaaaaagatcaactgccatcggcaaagctagcccttcac
tacctcctcacgacggtgctaccgtacgccaaagaaaacgctcaatttcgcctaaccaac
tggtcgcgggtgcaaaagctcctccagctagcggaaaacgcactggtcctgtttaatctg
gttaactttttcaagtttctccgctccggtacgcgaccctcgctggtggattgtttgctg
cgcattaaccaccgctcgctggacggtgcgaagcgacgcacgatcggctactcgtacatg
acgcgcgagctggtttgggctggctttatggagctgctcggatttacgatcccgttcgtg
aactatcacgcgctgaagcgaaagctgcgcaatttgctgcgcattgaagcggcaccccag
cggcaggatgagcacgttgagctgaccgtggacacgagatgtgcgtactgcaatgagcga
gtgattctacctcaccacatgggctgcaggcacgtgttttgctacctgtgtctgaagggc
aatcagctggcggatgctggattccagtgtaatgtgtgtgactaccgcagtgaaacgttc
cggaaggttgttgtattgtag

DBGET integrated database retrieval system