KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011133
Entry
AgaP_AGAP011133   CDS       T01036                                 

Definition
(RefSeq) AGAP011133-PA
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00230  Purine metabolism
aga00983  Drug metabolism - other enzymes
aga01100  Metabolic pathways
Module
aga_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AgaP_AGAP011133
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    AgaP_AGAP011133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aga04147]
    AgaP_AGAP011133
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     AgaP_AGAP011133
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP011133
  Exosomal proteins of breast cancer cells
   AgaP_AGAP011133
SSDB
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth NanE ThiG Dus Glu_synthase DHO_dh Aldolase YpsA
Other DBs
NCBI-GeneID: 1270793
NCBI-ProteinID: XP_309514
VectorBase: AGAP011133
UniProt: Q7QHD0
Position
3L
AA seq 538 aa
EACVRACVFGVWPTGNAWLIPAGLRTMENGTSNNLQDGLSCEELFRKSDGLTYNDFIILP
GYIDFTAEEVDLSSPLTKKIMLKAPLVSSPMDTVTEAEMAISMALCGGIGIIHHNCTPEY
QANEVHKVKKYKHGFIRDPLVMGPENTVADVLEAKRKNGFTGYPITENGKIGTRLVGIVT
SRDIDFREHDVDIKLKDIMTKLEDLITAPNGVTLQEANNIMEKSKKGKLPIVNKTGELVA
LIARTDLKKGRTYPNALKDSNKQLLVGAAIGTRDEDKERLELLYQNGVDVIVLDSSQGNS
LYQINMIKYIKEKYPSLQVIAGNVVTRQQAYNLITAGCDALRVGMGSGSICITQEVMACG
CPQATAVYQVCNLARQYGVPVIADGGIQSIGHIVKALSLGASAVMMGSLLAGTSEAPGEY
YFSDGVRLKKYRGMGSLEAMERKDGKGSASSRYYHTEIEKMRVAQGVSGSIVDKGSILRF
VPYLLCGLQHSCQDIGARSIANLRKMIYNGELRFMKRTHSAQLEGNVHGLFSYEKRLF
NT seq 1617 nt   +upstreamnt  +downstreamnt
gaggcgtgcgtgcgtgcgtgtgtgtttggtgtgtggccaacaggcaacgcgtggttaatt
ccggccggactaaggacgatggagaacggcacgtccaacaatctgcaggatgggctttcc
tgcgaggagctgttccggaaaagtgacggcctgacgtacaatgactttattatcctgccc
ggttacatcgatttcacggcggaagaggtggacctgtcctcgccgctgacgaagaaaatc
atgctgaaggcaccgctcgtctcctcgcccatggatacggtgaccgaagccgaaatggct
atctcgatggcgctgtgcggtggcatcggcattatccatcacaactgcacccccgagtac
caggcgaacgaggtgcacaaggtgaagaagtacaagcatggctttatccgcgacccgctg
gtgatggggccggaaaacacggtcgcggacgtgctggaggcgaagcgcaagaacggcttc
accggctacccgatcacggagaatggcaaaatcggcacccggctggtcggcatcgtgacg
tcgcgcgacatcgacttccgcgagcacgacgtggacatcaagctgaaggacatcatgacg
aagctggaggatctcattaccgccccgaacggggtgacgctgcaggaagcgaacaacatt
atggagaagagcaaaaagggcaagctgccgatcgtgaacaagacgggcgagctggtcgca
ctgattgcgcgcaccgatctgaagaagggccgcacctacccgaacgcactgaaggacagc
aacaagcagctgctggtcggcgctgcgatcggtacgcgcgacgaggacaaggagcggctg
gagctgctgtaccagaacggggtggacgtgatcgtgctcgattcgtcccagggcaactcg
ctctaccagatcaacatgatcaagtacatcaaggagaagtacccgtcgctgcaggtgatt
gcgggcaacgtggtgacgcgccagcaggcgtacaatctcatcacggccgggtgcgatgcg
ctgcgcgtcggcatgggctcgggctcgatctgcatcacgcaggaggtgatggcgtgcggg
tgcccgcaggccacggccgtgtatcaggtgtgcaatctggcccgccagtacggcgtgccg
gtcattgcggacggtggcatacagtcgatcgggcacatcgtgaaggcgctgtcactgggc
gcgtccgcggtgatgatgggatcgctgctggccggcacttcggaggcgcccggggagtac
tacttcagcgatggcgtgcggctgaagaagtaccgtggcatgggcagcttggaggcgatg
gagcgcaaggacggcaaggggtcggccagctcgcgctactaccacacggagattgagaag
atgcgggtggcgcagggcgtgagcggttcgattgtggacaagggctcgatcctgcgcttc
gtgccgtacctgctgtgcgggctgcagcacagctgccaggacattggcgcacgttccatc
gctaacttaagaaaaatgatctacaacggtgagctgcgcttcatgaagcgcacccactcg
gcccagctcgagggtaacgtgcacggtctgttctcgtacgagaagcgcctgttctga

DBGET integrated database retrieval system