KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011167
Entry
AgaP_AGAP011167   CDS       T01036                                 

Definition
(RefSeq) AGAP011167-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB
Motif
Pfam: JHBP
Other DBs
NCBI-GeneID: 1270762
NCBI-ProteinID: XP_309482
VectorBase: AGAP011167
UniProt: Q7QHF4
Position
3L
AA seq 256 aa
MISVNALACCLVSIWFLTLGTHTIEGKDLPTSFEKCHRNDPQFDQCLRSAVNGAIRLLKD
GLPDFGILPLEPLAVDSLVIEQGEPSSPIKLKQHFTNVRLSHLTESTILKYRTDLKKLII
KAEAITPQVQFAGNYTMDGRILVLPITGKGLANITLHRLKTHHELIGELVERNGEQYMHI
RKYLVHFEPKLVTFQFGNLFNGDERLGKTMHQVLNDNWEVVFRELRSSYEDTFGYIFKKI
SNQIFLKVPMNKIFPQ
NT seq 771 nt   +upstreamnt  +downstreamnt
atgatcagtgtaaacgcgctcgcgtgctgcctagtgagcatttggttccttacgctgggc
acgcacaccatcgagggaaaagatttgcccaccagcttcgagaagtgccaccgaaacgat
ccccagttcgatcagtgtctgcggagtgcggtcaacggtgcgatacggctgctgaaggat
gggctgcccgactttggcattctgccgctggaaccgctcgccgtcgattcgctggtcatt
gagcagggtgaaccatcgtcgccgatcaagctgaagcaacatttcaccaacgttcggtta
agtcatcttaccgaatcgaccatcctgaagtatcgaacggatctcaaaaaactcatcatc
aaggcggaagcgatcacgccgcaggtacagtttgccggcaactacacgatggacgggcgg
atactggtgctgccgatcacgggcaaagggttggccaacattacgctgcaccggttgaag
acacaccacgagctgattggcgagctggtggagcggaacggtgagcagtacatgcacata
cgaaagtatttggtgcactttgagccaaagctggtcacgtttcagtttgggaatcttttc
aacggcgatgaaaggctcgggaaaaccatgcaccaagtgctgaacgataactgggaggtc
gtgttccgggagctgcgcagctcgtatgaggacacgtttgggtacatcttcaaaaagatt
tccaaccaaatcttcctaaaggtaccgatgaataaaatattcccgcagtag

DBGET integrated database retrieval system