KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011514
Entry
AgaP_AGAP011514   CDS       T01036                                 

Definition
(RefSeq) AGAP011514-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB
Motif
Pfam: Actin GerD
Other DBs
NCBI-GeneID: 1275976
NCBI-ProteinID: XP_315271
VectorBase: AGAP011514
UniProt: Q7Q7K4
Position
3L
AA seq 233 aa
MCDDDAGALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGNKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLD
LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAA
NT seq 699 nt   +upstreamnt  +downstreamnt
atgtgtgatgatgatgcgggagcacttgtcgttgacaacggatccggaatgtgcaaggcc
ggattcgccggtgatgacgccccacgtgccgtcttcccgtccattgttggccgtccccgt
caccagggtgtgatggtcggtatgggcaacaaggactcgtacgtcggtgatgaggcccag
tccaagcgtggtatcctcaccctgaagtacccgatcgagcacggtatcatcaccaactgg
gatgatatggagaagatctggcaccacaccttctacaatgagctgcgcgtcgccccggag
gagcacccagtcctgctgactgaggccccgctgaacccgaaggctaaccgcgagaagatg
actcagatcatgtttgagaccttcaactcgccggccatgtacgtcgccatccaggccgtg
ctgtccctgtacgcttccggtcgtaccaccggtattgtgctggactccggcgatggtgtc
tcccacaccgtcccaatctatgaaggttatgctctgccgcacgccatcctccgtctggat
ctggctggtcgcgatctgaccgactacctgatgaagatcctgaccgagcgcggctactcg
ttcaccaccacggctgagcgtgaaattgtccgcgacatcaaggagaagctgtgctacgtc
gctctggacttcgagcaggaaatggccaccgccgctgcc

DBGET integrated database retrieval system