KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011516
Entry
AgaP_AGAP011516   CDS       T01036                                 

Definition
(RefSeq) AGAP011516-PA
Organism
aga  Anopheles gambiae (mosquito)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 1275974
NCBI-ProteinID: XP_315269
VectorBase: AGAP011516
UniProt: Q7Q7K6
Position
3L
AA seq 382 aa
TNNKSKMCDDDAAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSY
VGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPK
ANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPH
AILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAAS
TSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDL
YANTVLSGGTTMYPGIADRMQKEITALAPSSIKIKIIAPPERKYSVWIGGSILASLSTFQ
AMWISKQEYDESGPGIVHRKCF
NT seq 1149 nt   +upstreamnt  +downstreamnt
acaaacaacaaatccaaaatgtgtgatgatgatgctgccgcactggtcgtcgacaacgga
tccggaatgtgcaaggccggtttcgctggagatgatgctccgcgtgccgtgttcccgtcc
attgtgggacgtccgcgccaccagggtgtgatggtcggtatgggccagaaggactcgtac
gtcggtgatgaggcccagtccaagcgtggtatcctcacgctgaagtacccgatcgagcac
ggtatcatcaccaactgggatgatatggagaagatctggcaccacaccttctacaatgag
ctgcgcgtcgccccggaggagcacccagtcctgctgacggaggccccgctgaacccgaag
gcaaaccgcgagaagatgactcagatcatgtttgagaccttcaactcgccggccatgtac
gtcgccatccaggccgtgctgtccctgtacgcttccggtcgtaccaccggtattgtgctg
gactccggcgatggtgtctcccacaccgtcccaatctatgaaggttatgctctgccgcac
gccatcctccgtctggatctggctggtcgcgatctgaccgactacctgatgaagatcctg
accgagcgcggctactcgttcaccaccacggctgagcgtgagattgtccgtgacatcaag
gagaagctgtgctacgtcgctctggacttcgagcaggaaatggccacggccgctgcctcg
acctcgctggagaagtcgtacgagctgccggacgggcaggtcatcaccattggcaacgag
cgtttccgctgcccggaggctctgttccagccgtcgttcctgggtatggaatcgtgcggt
atccatgagacggtgtacaactccatcatgaagtgcgacgtcgacatccgtaaggatctg
tacgccaacactgtgctgtccggtggtactaccatgtatccaggtattgccgatcgtatg
cagaaggaaattaccgccctggcaccgtcctcgatcaagatcaagatcattgccccgccg
gagcgtaagtactccgtctggatcggtggatcgatcctggcttcgctgtccaccttccag
gccatgtggatctccaagcaggagtacgacgaatccggcccaggaatcgtccaccgcaag
tgcttctaa

DBGET integrated database retrieval system