KEGG   Anopheles gambiae (mosquito): AgaP_AGAP011890Help
Entry
AgaP_AGAP011890   CDS       T01036                                 

Definition
(RefSeq) AGAP011890-PA
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aga01001]
    AgaP_AGAP011890
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AgaP_AGAP011890
Protein kinases [BR:aga01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   AgaP_AGAP011890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 1280769
NCBI-ProteinID: XP_320635
VectorBase: AGAP011890
UniProt: Q7PZG1
Position
3L
AA seq 352 aa AA seqDB search
QQMAMPRQPKMTPITDDYDISNTVLGLGINGKVVQCTSKSTGQKYALKVLHDNAKARREV
ELHWRASGCRNIVNVIDVYENSYGGNRCLLVVMECMEGGELFQRIQERQDGPFTEREAAQ
VMHEICVAVKYLHDSNIAHRDLKPENLLYTSPHPNAILKLTDFGFSKETFIKDTLQTPCY
TPYYVAPEVLGPEKYDKSCDIWSLGVIMYILLCGFPPFYSNQGLAISPGMKARIRTGQYD
FPNPEWKKVSQAAKDLIKDMLNVEPEKRLTIEQVMMNPWIRRYTEVPQTPLHTGRMLKEG
EEIWPEVQEEMTRSLANMRVDYEMHIKNLDSSNNALLNKRRKRVEEKAAPKE
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
cagcagatggccatgccgcgacaaccgaagatgacgccgatcacggacgactacgacatc
tccaacacggtgctcgggctcggcatcaacggcaaggtggtgcagtgcacgagcaagtcc
accggccaaaagtatgccctcaaggtactgcacgacaatgccaaggcccggcgcgaagtg
gagctacattggcgggcgagcggatgccgaaacattgtaaatgtcatcgatgtgtacgag
aatagctacggcggcaatcgatgcttgctcgtcgttatggaatgcatggagggtggcgaa
ctattccaacgaattcaagaaagacaggatggcccattcacggaacgagaggccgcccaa
gtcatgcatgaaatctgtgtcgctgtcaagtacttgcacgattccaacatcgcacaccgt
gatctcaagccggaaaacctgctgtacacgtcgccccacccgaacgccatactaaaactg
accgattttggcttctcgaaggaaacgttcatcaaggacacgctgcagacgccctgctac
acgccgtactacgtcgcgccggaagtgctggggccggagaagtacgacaagagctgtgat
atttggtcgctcggtgttatcatgtacattctgttgtgcggatttcctccgttctacagc
aaccaggggctagctatctcgcccggcatgaaagcacgcatccgcaccggacagtacgac
ttcccgaacccggagtggaagaaggttagccaggcggccaaggacctgatcaaggatatg
ctgaacgtggagccggagaagcggctcacaattgagcaagtgatgatgaacccttggatt
cggcgctacaccgaggtgccccaaactccgctacacaccgggcgcatgctgaaggagggc
gaagaaatttggcccgaggtgcaggaagagatgacccgctcgctggccaacatgcgggtc
gattatgagatgcacatcaagaatctggacagctcaaacaatgcactgctcaacaagcgg
cgaaagcgcgtggaagaaaaggctgcccccaaagaataa

DBGET integrated database retrieval system