KEGG   Anopheles gambiae (malaria mosquito): AgaP_AGAP011940
Entry
AgaP_AGAP011940   CDS       T01036                                 
Name
(RefSeq) AGAP011940-PA
  KO
K12350  sphingomyelin phosphodiesterase [EC:3.1.4.12]
Organism
aga  Anopheles gambiae (malaria mosquito)
Pathway
aga00600  Sphingolipid metabolism
aga01100  Metabolic pathways
aga04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AgaP_AGAP011940
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    AgaP_AGAP011940
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     AgaP_AGAP011940
SSDB
Motif
Pfam: Metallophos ASMase_C SapB_1
Other DBs
NCBI-GeneID: 1280729
NCBI-ProteinID: XP_320591
VectorBase: AGAP011940
UniProt: Q7PZJ1
Position
3L
AA seq 673 aa
AHPFLFNSGNHRPPVEWKTPEDNWTAEAAPRSIYPLLQNQNNKHQLPPRYAVIESDEDEQ
LLRRAHEAKENATARTLFYSPKEESHLPPLLTKTIKYFNLQQVAFELETSVMSQVSCTAC
KAGAGLLQHYIRTGKSKEEIIKMIYQYCVQLKIQSARVCEGVSQLFGVEVIYVLKRITIG
PDEICSFIIGDACGDIYNPYHEWEVEFPPVPKPDPRELGLPKEAAPVFKVLHLSDTHFDP
YYAEGSNADCNEPLCCRLTNGRPTTPNGAAGKWGDYRKCDTPKRTVDHMLNHIADTHSDI
DFIIWTGDLPPHDVWNQTKEENLKVLKETVTQMTEKFPGIPIFPALGNHESAPVNSFPPP
YVQQVDSSIAWLYDELDVQWRRWLPASVSHTVRRGAFYSVLVRPGYRIISLNMNYCNNKN
WWLLLNSTDPATELQWFIYELQSAEFAGEKVHVIGHIPPGHSDCLKVWSRNYYKIVSRFE
STITAQFFGHTHFDEFEVFYDPHDLSRATSIAYIGPSVTPYNDLNPGYRIYYIDGDHDET
TRLVVDHESWIMNLKEANLYDYPIWYKLYSTRAAYGMKGLRPADWDQLINNMTDSKELFD
LYYKHYWKASPVKPECDYECRKRILCDAKSGRSHDRKYFCEEVEAKIDESNKGWKDWLFS
SISSSYVLYKKLF
NT seq 2022 nt   +upstreamnt  +downstreamnt
gcacatccgtttctgttcaactcgggtaatcaccgcccgccggtagaatggaagacgccg
gaggataactggacggcggaggcagcaccgcgcagcatctatccgctgctgcagaatcag
aacaacaagcaccagctaccaccacggtacgcggtaatcgagagcgacgaggacgagcag
ctgttgaggcgtgcgcacgaggcgaaagagaatgcaaccgcccggacgctgttctactcc
cccaaggaggagtcgcatctaccgcccctgctcaccaaaacgatcaagtacttcaatctg
cagcaggttgcgttcgagctggaaacgagcgtcatgtcgcaggtctcctgcaccgcgtgt
aaggcgggcgctggactgttgcagcattacatacgcaccgggaaaagcaaggaagagatc
atcaaaatgatttaccagtactgtgtgcagctgaagatccagtcggcacgagtctgcgaa
ggagtgagccagctgttcggggtggaggtgatctacgtgctgaagcgcatcacgatcggg
ccggacgagatctgtagcttcatcatcggggacgcttgcggagacatttacaacccgtac
cacgagtgggaggttgagttcccgcccgtcccgaagccggacccacgggagctgggtctg
ccgaaggaagcggcccccgttttcaaggtgctgcatctgtccgatacgcacttcgatccg
tactatgcggagggttcgaacgcggactgcaatgagccgctgtgctgtcggctgacgaat
ggacgaccgactacaccgaatggtgcggctggcaagtggggtgactatcgaaagtgtgac
acgccgaagcgaactgttgatcacatgctgaaccacatcgctgatacgcactcggacatt
gatttcatcatctggacgggtgatctgccaccgcacgacgtgtggaatcagaccaaggag
gagaatttgaaggtgctgaaggagacggtgacgcagatgacggagaagttcccgggtata
ccgatattcccggcgttgggtaatcatgagagtgccccggtgaacagcttcccgccaccg
tacgtacagcaggtggacagttcgatcgcgtggctgtacgatgagctggatgtgcagtgg
cggcgttggttgccggcaagcgtctcgcacacggtaaggcgcggtgctttctactcggtg
cttgtgcgtcctgggtatcgaatcatctcgctcaacatgaactactgcaacaacaagaac
tggtggctgctgcttaactcgaccgatcccgctaccgagctgcagtggttcatctacgag
ctgcagagtgcggagtttgcgggtgaaaaggtgcacgtgattggacacattcccccgggg
cattccgattgtctgaaggtgtggagcaggaattactacaaaattgtgtcccgcttcgag
agcaccattacggcacagttctttggccacacgcacttcgacgagtttgaggtgttttac
gatccgcacgatttgagccgggcgaccagcatcgcgtacattggaccatcggtgacgccg
tacaatgatctgaatccgggctatcggatctactacatcgatggagatcacgatgaaact
acacggctagtcgtagatcatgaatcgtggatcatgaacctgaaggaggctaatctctac
gattaccccatctggtacaagctgtactcgacacgggcagcgtacggcatgaagggtctg
cgacccgccgactgggatcaactaatcaacaacatgactgacagtaaggagctgttcgat
ctgtactacaaacactactggaaggcctcgccagtgaagccggaatgtgattatgagtgc
cgcaagcgcatcctgtgcgacgcgaagagtggacgatcgcacgatcgcaagtacttctgc
gaggaggtggaggcgaaaatcgacgaaagcaacaagggctggaaggattggctctttagc
tcgattagctcttcgtacgtactctacaagaaactgttctag

DBGET integrated database retrieval system