KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012066Help
Entry
AgaP_AGAP012066   CDS       T01036                                 

Definition
(RefSeq) AGAP012066-PA
  KO
K08585  calpain, invertebrate [EC:3.4.22.-]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aga01002]
    AgaP_AGAP012066
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     AgaP_AGAP012066
Peptidases and inhibitors [BR:aga01002]
 Cysteine peptidases
  Family C2: calpain family
   AgaP_AGAP012066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 1280603
NCBI-ProteinID: XP_320459
VectorBase: AGAP012066
UniProt: Q7PZT1
Position
3L
AA seq 761 aa AA seqDB search
MAAQACPTPNSSSAHVKGPSAPFGSYRSSTRFLPVTFENDEVRRPRYNSTISNHHQHFYT
LRQQCLSEGRLFEDPDFPATDASIGMPKFINVRWKRPKELTPTARFFIDGASRLDICQGA
LNDCWLLTAATNLTSHPWLFRRVLPGDNSFREEQQYAGAFHFRFWEFGQWVEVVIDDRLP
TDATGKLLFGRSANGDEYWSALLEKAYAKFYGSYGALDGGTAREAMQDLTGGLTEFYQPK
KMADGQEDQLWDILRSGSEMGSLFACNLKSDPTGENVATKEGLLRGHSYSITKVCSIPGL
VSGSDDIRLLRIRNPWGTGIEWNGRWSDKSREWKSLNQAERKRVGLTVENDGEFWIELVD
FMKHFDRLEVCHLSPELHSIEEDGAGDRTSSTRRYRWELSALDGQWIRDTTAGGNISFLD
TFPLNPQYTIHVQDGTTGSGVVIALMQKYRRADSLPSLTIGFTVYRVTVEDLRQKPVPRE
FFQHHDHAIVGGSIFINAREISCRLTLDAGLYLVIPSTFEPGEEGDYLLRIFTARGNTLC
ENDATLCFGTLDDRITEQGKFFDTPRWALLANAFYNRAEGDKQLLNTASLCDILWEQFFR
PNVPKRPQPKQQTSGGSSPWRKFYSCVLQLCACFWIQSAVRKSRRAGEPIVQEDQAHRGE
LERIVKLLMGRIADGQDTIGYEQYRTIARDVYQWESVFRLYDMDGSGTLDRRELRHALRS
SGFNTNNRILCRLQRLMVELNRPQIELIEYVLCAAECRHAI
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcaggcgtgtcccacgcctaattcatccagcgcacatgtcaaaggcccatct
gcaccgttcggcagttaccgctcctcgacacgctttttgcccgttacgtttgaaaatgat
gaggtaagaagacctaggtacaactccaccatcagcaaccatcaccaacacttctacacc
ctccggcagcaatgcctatccgagggccgtctctttgaagatcccgactttcccgcaacg
gacgcctcgatcggtatgcccaaattcatcaacgtgcgctggaaacgcccgaaagagctt
accccaaccgcccggttcttcatcgacggtgcctcccggctggacatctgccagggcgca
ctgaacgactgctggctgctaacggccgccaccaatctgacctcccatccgtggctgttt
cggcgcgtactgccgggcgataatagcttccgggaggagcagcagtacgccggtgcgttt
cactttcgcttctgggagtttggccagtgggtggaggtggtgattgacgatcgactgccg
acggacgccacggggaagttgctgtttggcaggtcggctaacggggacgagtactggagt
gcgctgctggagaaagcatacgcaaagttttacggttcgtacggtgcgctggacggtggt
acggcgcgggaagcaatgcaggacctgaccgggggactgacggagttttatcagccgaaa
aagatggccgacgggcaggaggaccagctgtgggatatcttgcgcagtgggtccgagatg
gggtcactgtttgcctgcaacttgaagagtgatccaacgggtgagaacgttgccacgaag
gaaggtctattgcggggccattcttactccatcactaaagtgtgcagcatcccgggctta
gtgagcggtagcgatgacatccgtttgcttcgcatccgcaacccgtggggcaccggaatc
gagtggaatggccgctggagcgacaaatcccgcgagtggaagtccctcaaccaggcggaa
agaaagcgcgtagggctgacggttgaaaacgatggcgagttttggatcgaactggtcgac
tttatgaaacactttgaccggctggaggtttgccatctctcaccagaactgcacagcatt
gaggaagatggtgctggggatcgaacatcctctacccgtcgctatcgctgggagttaagt
gcactggacggtcagtggatccgggacacgacggccggagggaacatctccttcctggac
acattcccgctgaatccccagtacacgatccacgtgcaggatggtacaacgggttccggt
gtggtgattgcactgatgcaaaagtatcgccgggccgattcccttccaagcctcacgatc
gggttcaccgtgtacagggtgacggtggaggatctgcgccaaaagcccgtcccgagggag
ttcttccagcaccacgatcacgcgatcgttggtggatcgatttttatcaatgcgcgtgaa
atcagttgccgattaacgctggacgctggcctgtatctcgtcattccttcaacgttcgag
ccaggggaggaaggtgactatctgctccggatctttaccgcccgtgggaacacactgtgt
gagaacgatgcaacgctttgcttcggcacgctggacgatcgtatcaccgagcaggggaag
ttcttcgacacaccacggtgggcactgctcgcgaatgcattctacaatcgtgcagaggga
gacaagcaactgctcaacacagccagtctgtgtgacattctgtgggaacagtttttccgc
ccgaacgttccgaagcggccacaaccgaaacagcagacgagcggtggttcttctccgtgg
aggaagttctactcctgtgtgctgcagctttgtgcctgcttctggatacaatcggcagtg
aggaagagtcgtcgagcgggggagccgatcgtgcaggaagatcaagcccatcggggggag
ctggaacggattgtgaagctactgatggggcgcattgccgatgggcaggatacgatcggg
tacgaacagtaccgtacgatcgcacgggatgtgtatcagtgggagtcggtgttccggctg
tacgatatggatggcagtggcacgctggatcggcgtgagctgcgccatgcgctacgatct
tccggctttaatacgaacaatcgcatcctgtgccggttgcagcgattgatggtggagctg
aaccgaccgcagatcgagctgatcgagtatgtgctgtgtgcggccgagtgtcgtcatgcg
ata

DBGET integrated database retrieval system