KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012119Help
Entry
AgaP_AGAP012119   CDS       T01036                                 

Definition
(RefSeq) AGAP012119-PA
  KO
K11366  ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AgaP_AGAP012119
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AgaP_AGAP012119
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     AgaP_AGAP012119
Ubiquitin system [BR:aga04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    AgaP_AGAP012119
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     AgaP_AGAP012119
    SLIK complex
     AgaP_AGAP012119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 zf-UBP Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 1280557
NCBI-ProteinID: XP_320409
VectorBase: AGAP012119
UniProt: Q7PZW5
Position
3L
AA seq 527 aa AA seqDB search
KRARKMGDAGCVHFATYVKEYGYEPYSYVHGYFSACVNKEARLRKALSCLCYKCGSSGPQ
LYCCLHCIYFACKGAHITEHYKHTKHFMALELCYGMLYCYQCRDFIYHSKCQTIAERHLW
LEARSLDKSLSWRPWSPSRLEIELLLKNPKRRHVTALTSIGLRGLLNLGSTCFMNCIVQA
LIHTPLLRDYFLAELHECTAKTAAKCLVCEVSRLFQEFYSGARGPLSLHRLLHLIWNHAR
HLAGYEQQDAHEFFIATLDVLHRHCKTGSNYLQQQAEPNQTQCNCIIDQIFTGGLQSDVV
CQACNGVSTTIDPFWDISLDLGESSNGQGGYGGPPRSLIDCLERFTRAEHLGSSAKIKCN
KCNSYQESTKQLSMRTLPIVASFHLKRFEHSSLIDKKISTFISFPAELDMTPFMSQIMSD
QQQQQQQQQSAVPHSPSSSSSNFNERTGGANGSSTGTSLNSDSTARLPVDKSTTDFRYSL
YAVINHVGTLDAGHYTAYVRHQKDIWVKCDDHIITTATLQQVLDSEG
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
aagcgggcgcggaaaatgggcgatgccggatgtgtacactttgcgacgtacgtgaaggag
tacgggtacgagccgtacagctacgtgcacgggtacttcagtgcgtgcgtcaacaaggag
gcccggctgcggaaggccctctcctgcctgtgctacaagtgtggtagctccggtccgcag
ctgtactgctgcctgcactgcatctacttcgcctgcaagggcgcccacattaccgagcac
tacaagcacacgaagcacttcatggcgctggaactgtgctacggcatgctgtactgctac
cagtgtcgggactttatctaccacagcaaatgccagacgatcgccgagcggcacctctgg
ctggaggcgcgcagtctcgacaaaagcctgtcctggcgcccgtggagtccctcgcggctc
gaaatcgagctgctgctgaagaaccccaagcgccggcacgtaaccgcactcaccagcatt
gggctgcgcgggttgctgaatctcggctcgacctgcttcatgaactgcatcgtgcaggcg
ctcatccatacgcccctgctgcgcgactacttccttgccgagctgcacgagtgtacggcg
aaaacggccgccaagtgtttggtgtgtgaagtgtcgcggctgtttcaggaattttactcc
ggcgcccggggtccactgtcgctgcaccggttgctgcatctgatctggaaccatgcgcgg
catttggctgggtacgagcagcaggacgcgcacgagttcttcatcgccacgctggatgtg
ctgcatcggcactgcaaaaccggctcgaactatcttcagcagcaagcggagccaaaccag
acacagtgcaactgtattattgatcagatcttcaccggcggtctgcagagtgatgtcgtg
tgccaggcgtgcaacggtgtctcgaccacgatcgatccgttctgggacatttcgctcgat
ctgggcgaatcgtccaacgggcagggtgggtacggtggaccgccccggtccctgatcgac
tgtctggagcgattcacccgggcggagcatctcggctcgagtgcaaagatcaaatgcaac
aagtgcaacagctaccaggagtcgaccaagcagctgtccatgcgcacgttaccaatcgtc
gccagcttccatctcaagcgcttcgaacactctagtctgatcgataagaaaatttccacc
tttatctcattccctgccgagctcgatatgacaccgtttatgtcacagataatgtctgac
cagcagcagcagcagcagcaacagcaatcggccgttcctcattcaccgtcgtcctcgtcg
tcgaatttcaacgagcgaactggtggagcaaacggttcctctaccggcacgagtttaaac
agtgactcgacggcacgcctgccggtggacaagagtacgaccgattttcgctattcgctg
tacgccgtcatcaatcacgtcgggacgctcgatgcgggccactacacggcgtacgtgcgc
caccagaaagacatttgggtcaagtgcgatgaccacattataaccactgccacactccag
caggttttggacagcgaagggtaa

DBGET integrated database retrieval system