KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012140Help
Entry
AgaP_AGAP012140   CDS       T01036                                 

Gene name
EIF3B_ANOGA
Definition
(RefSeq) AGAP012140-PA
  KO
K03253  translation initiation factor 3 subunit B
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga03013  RNA transport
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP012140 (EIF3B_ANOGA)
Messenger RNA biogenesis [BR:aga03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     AgaP_AGAP012140 (EIF3B_ANOGA)
Translation factors [BR:aga03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AgaP_AGAP012140 (EIF3B_ANOGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2A RRM_1 DHC_N1
Motif
Other DBs
NCBI-GeneID: 1280537
NCBI-ProteinID: XP_320387
VectorBase: AGAP012140
UniProt: Q7PZY1
Position
3L
AA seq 683 aa AA seqDB search
MAKKKGEEQDFEEEPNFDDPEGFVDDVSDEELLGDFLRQKPCESDGVENVIVVDNIPVVG
AARFPKLKGIIEKIFKNAGTIVNVHYPKDEEDNTKGYAFVEYKNQESAEEAVKSLNNYRL
DKHYTLLVNRFADFQKYSDIPKEWSPPQPQPYKVQNDLYNFLLEADAQDQFCVVSETVPG
SVQVQFCQNTQPEPTELLKRERFTDTYVKWSPKGTYIVTFHKQGVVVWGGSSFVKVNKFA
HSNAQFVDISPCEQYLVTYGPNGQKIVIWDIRTGAEKRTFVSDGMSNASMLRWSHDDRYV
ARLVDSQIQIYDTTTFFLLDMKSIRVEGIRNFSWSPTDNIIAYWVAEEVDVPAKVTLMAI
PKKTELRTKNLFNVADCKIHWQKSGDYLCVKVDRFSKSKKEKKDKKDSDVKFLGMFYNFE
IFHMREKDIPVDSVEVKETILAFAWEPVGSKFSIIHGEPSSANVSFYETNKGQEPVLVKK
LEKKVCGHLFWSPRGQFIVLANLQMGTFEFVDTNDFSIMKTGDHYRASEVEWDPTGRYVV
TGTSGKAKEDQGYYMWSFQGRILKRVNLKNFMLFLWRPRPPTLLSDAKQKEILKNLKKYY
SQFESKDRLRMTRASKELIEKRAKLREQFTEYRSKRVKEWEDQKKRRMQLRNNVDTDTLE
ADPDNVEEEIVEILVREDTTVIE
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaagaagggagaagagcaggactttgaggaggagcccaactttgacgatccg
gagggattcgtggacgatgtatcggacgaggaactgcttggagacttcctgcggcagaag
ccgtgcgaatcggacggcgttgagaatgtgattgtcgtggacaacattccggtcgtcggt
gcggcccgcttccccaagctgaagggcatcatcgagaagatcttcaagaatgccggcacg
atcgtgaacgtccactacccgaaggacgaggaggacaacaccaaggggtacgcgttcgtc
gagtacaagaaccaggagagcgcggaggaggcggtcaagtcgctgaacaactaccggctg
gacaagcactacacgctgctggtgaaccggttcgccgacttccagaagtactcggacatc
ccgaaggaatggtccccgccccagccgcaaccgtacaaggtgcagaacgacctgtacaac
ttcctgctggaggcggacgcccaggaccagttctgcgtggtgtcggaaacggtgcccggc
tcggtgcaggtacagttctgccagaacacgcagccggaaccgacggagctgctcaagcgc
gagcggttcaccgacacgtacgtcaagtggtccccgaagggtacgtacatcgtgacgttc
cacaagcagggtgtcgtcgtgtggggcggctcgagcttcgtcaaggtgaacaagttcgcg
cacagcaacgcacagttcgtggacatttcgccctgcgagcagtatctggtgacgtatggc
ccgaacggccagaagatcgtcatctgggacatccgcaccggggcggagaagcgcacgttc
gtgtcggacggcatgtcgaacgcgtccatgctgcgctggtcgcacgatgaccggtacgtg
gcccggctggtcgacagccagatccagatctacgacacgaccaccttcttcctgctcgac
atgaagtcgatccgggtggagggcatccgcaacttcagctggtcgccgaccgacaacatc
atcgcctactgggtcgcggaggaggtggacgtgccggcgaaggtgacgctgatggcgatc
ccgaagaagacggagctgcgcacgaagaacctgttcaacgtggccgactgcaagatccac
tggcagaagtcgggcgactacctgtgcgtgaaggtggaccggttctccaagtcgaagaag
gagaagaaggacaagaaggactcggacgtgaagttcctcggcatgttctacaactttgag
atattccacatgcgcgagaaggacataccggtggattcggtcgaggtgaaggaaacgatc
ctggcgttcgcctgggagccggtcggctcgaagttctccatcatccacggcgagccgtcg
tccgccaacgtgagcttctacgagacgaacaagggccaggagccggtgctggtgaagaag
ctggagaagaaggtgtgcggccacctgttctggtcgccccggggacagtttatcgtgctg
gccaacctgcagatgggcacgttcgagtttgtcgacacgaacgatttcagcatcatgaag
acgggcgaccactaccgtgcctcggaggtggagtgggacccgaccggtcggtacgtcgtg
acgggcacttccggaaaggctaaggaagaccagggctactacatgtggtcattccagggg
cgcatactgaagcgcgtcaatctgaagaacttcatgctgttcctgtggcggccgcgccca
ccgaccctgctgtcggacgccaagcagaaggagattctcaagaacctcaagaagtactac
tcgcagttcgagagcaaggaccgtttgcgtatgacgcgcgcatccaaggagctgatcgag
aagcgtgccaagctgcgcgagcagttcaccgagtaccgatcgaagcgcgtcaaggagtgg
gaggaccagaagaagcgtcgcatgcagttgcgaaacaacgtcgacacagatacgctggag
gctgatccagataatgtagaggaggaaattgttgaaatacttgtacgtgaagataccacc
gtcatcgagtaa

DBGET integrated database retrieval system