KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012202Help
Entry
AgaP_AGAP012202   CDS       T01036                                 

Gene name
H2B_ANOGA_c
Definition
(RefSeq) AGAP012202-PA
  KO
K11252  histone H2B
Organism
aga  Anopheles gambiae (mosquito)
Brite
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AgaP_AGAP012202 (H2B_ANOGA_c)
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP012202 (H2B_ANOGA_c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931 DUF1764
Motif
Other DBs
NCBI-GeneID: 1280483
NCBI-ProteinID: XP_320329
VectorBase: AGAP012202
UniProt: Q27442
Position
3L
AA seq 124 aa AA seqDB search
MAPKTSGKAAKKSGKAQKNISKSDKKKKRKTRKESYAIYIYKVLKQVHPDTGISSKAMSI
MNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaagaccagcggcaaggcagctaagaagtccggcaaggcgcagaagaacatc
tccaagtcggacaagaagaagaagcgcaagacccgcaaggagagctacgccatctacatc
tacaaggtgctgaagcaggtgcacccggacaccggcatttcctccaaggcgatgagcatc
atgaacagcttcgtgaacgacatcttcgagcggatcgcggcggaagcgtcccgcctggcg
cactacaacaagcgctccaccatcacgtcccgcgagatccagacggcggtgcgactgttg
ctccccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcaccaagtac
accagttccaagtaa

DBGET integrated database retrieval system