KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012379Help
Entry
AgaP_AGAP012379   CDS       T01036                                 

Definition
(RefSeq) AGAP012379-PA
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AgaP_AGAP012379
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     AgaP_AGAP012379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase HIT DcpS_C
Motif
Other DBs
NCBI-GeneID: 1280334
NCBI-ProteinID: XP_320179
VectorBase: AGAP012379
UniProt: Q7PV69
Position
3L
AA seq 477 aa AA seqDB search
TYFMYSLLRKRVAQVLWQSSPTNIRTMATQTPARIAVAQMRSTNDKQHNFAQIQTITERA
KANDVQFIFFPECCDYVGTHRDETLKLSEPLTGPTVQRYRALAREQNVWLSFGGVHESII
EETESGQEVKNIYNTHILINNVGELVASYRKLHMFNVITPEFKFRESETVRSGPALIPPV
DTPIGRIGLQICYDMRFAEASTLLRKQGAEILTYPSAFAVSTGRAHWEVLLRARAIENQC
FVIAAAQIGFHNKKRESYGHAMVVNPWGTILGEANPDQDLDVVVAELDFGKLQSVRANMP
CFEHRRDDVYNLSTRASLPYANGATAKEKFSFGGIEIPPETIFYVSEHCFAFTNIRCVVP
GHVLVSTKRVAARLPDLSPAEINDFFQTVCKVEKVAERLYNATSSTVTVQDGPDAGQTVF
HVHCHVMPRHVGDFPENDQIYGELNRHDKEPERPRRPIAEMAAEAIRFREEMSRLGL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
acatatttcatgtattctttgctgagaaaacgagtcgcgcaagtattgtggcaatcgtca
cccaccaacatccgaacgatggctacgcaaaccccggcacgtattgccgttgcgcaaatg
cgctccaccaacgataagcaacacaactttgctcagatccaaaccatcaccgaacgggca
aaggccaacgatgtgcagtttatcttctttccagagtgctgtgattacgtaggaacccat
cgggacgaaacgctgaaactgtcggaaccacttacgggcccgacggtacaacggtaccga
gcgctggcacgggaacaaaacgtttggctttcgttcggtggagtgcacgaaagcatcatc
gaggaaacggaatcgggacaggaggtgaagaatatctacaacactcacatactgatcaac
aatgtcggcgagctggtggcaagctatcgcaagctgcacatgttcaacgtgattacaccg
gaatttaaattccgtgaatcggaaacagtccgatcgggtccggcattgataccgccggtt
gacacacccatcggacggataggtttgcagatttgctatgatatgcgttttgctgaagcg
agcacgcttttgcggaaacaaggtgccgaaatcctcacctatccttcagccttcgctgtg
tcgaccggacgagctcactgggaagtactgctgcgggcaagggcgatcgaaaatcaatgc
ttcgttattgccgccgctcaaattggattccacaacaagaagcgagagagttatggccac
gcaatggtagttaatccatggggaaccatcctaggagaagccaatccagatcaggatctg
gatgtcgtcgttgcggagttggactttggcaagctgcaaagtgtgcgcgccaatatgcca
tgtttcgagcaccggagggacgatgtttacaacctttcgacgcgagcaagccttccgtac
gccaatggtgctacagccaaagaaaagttctcgttcggaggtatagaaattcctcctgaa
acgatattctacgtatcagaacactgtttcgctttcaccaacattcgctgtgttgtgccc
ggacatgttctagtttcaacgaaacgtgtcgccgctcggctaccggatctcagcccggcg
gaaataaacgatttcttccagaccgtatgcaaggtggaaaaggtggcagagcggctgtac
aatgccacttcgtccaccgtgacggtacaggacggcccggacgcgggacagaccgttttc
cacgtgcactgtcatgtgatgccgcgccatgttggagactttcccgagaatgatcaaatc
tatggtgagttgaaccgacacgataaggaaccggaacggccacgacgacccatcgcagaa
atggctgcagaagcaatccgctttcgggaggaaatgtcacgattgggattgtga

DBGET integrated database retrieval system