KEGG   Anopheles gambiae (mosquito): AgaP_AGAP012422Help
Entry
AgaP_AGAP012422   CDS       T01036                                 

Definition
(RefSeq) AGAP012422-PA
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
KEGG Orthology (KO) [BR:aga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aga01001]
    AgaP_AGAP012422
   01009 Protein phosphatases and associated proteins [BR:aga01009]
    AgaP_AGAP012422
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AgaP_AGAP012422
Protein kinases [BR:aga01001]
 Serine/threonine kinases: Other
  Wnk family
   AgaP_AGAP012422
Protein phosphatases and associated proteins [BR:aga01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AgaP_AGAP012422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 3291579
NCBI-ProteinID: XP_551760
VectorBase: AGAP012422
UniProt: Q5TMX4
Position
3L
AA seq 375 aa AA seqDB search
PKVLKSWCRQILKGLHFLHSRTPPIIHRDLKCDNIFITGTTGSVKIGDLGLATLKNRSFA
KSVIGTPEFMAPEMYEEHYDEAVDVYAFGMCMLEMATSEYPYNECNTPAQIYKKVTSGVK
PQSLEKVENPEVREIIERCIHDKKEGRPTCKELLNCEFFCEDIGIRLEPMSKDMFLTNPE
IVRMEFRLRILDPKKRVNKHKENEAIQFDFDIRVDDAEEIANEMYRSEQQQEQKQQHQQQ
QQQQQQQQKQQEQQQQQEQQQQEQQQQEQQQQQQEQEQQQEQQQEQQQQQQQQQQQQQQQ
QQQQQQQKQQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQQQEQPQEQPQEQQQEQQQEQ
QQEQQQEQQQEQQQE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ccaaaagtactgaagtcctggtgtcggcaaattctaaaagggttgcatttcttgcattca
cgcacaccgcctatcatccatcgtgatttgaaatgtgataatatatttataactggtacg
acagggagcgttaagataggagacctaggattagccacactgaagaaccgtagctttgca
aagtcggttattggtacaccggagttcatggcacccgaaatgtatgaggaacattatgac
gaagcagttgatgtgtacgcttttggtatgtgcatgttggaaatggctacctcagagtat
ccgtacaatgaatgcaatacaccagcacagatttacaaaaaagtgacttctggtgtaaaa
ccgcaaagcctagaaaaggtggaaaacccagaggtacgtgagatcatcgaaagatgtata
cacgataaaaaagaaggacgaccaacgtgcaaggagcttttgaactgtgaatttttttgc
gaagatattggtattcggttggaaccaatgtcaaaagatatgttcctaacaaatcctgaa
atcgtccgtatggaatttcggctgcgtatcctggatcctaaaaagcgtgttaacaaacac
aaagagaatgaagccattcagtttgatttcgacattcgagtagatgatgctgaagaaatt
gctaacgaaatgtatagatcagaacaacaacaagaacaaaaacaacaacatcaacaacaa
caacagcagcaacaacaacaacaaaaacaacaagaacaacaacaacaacaagaacaacaa
caacaagaacaacaacaacaagaacaacaacaacaacaacaagaacaagaacaacaacaa
gaacaacaacaagaacagcaacaacaacaacaacaacaacaacaacaacaacaacaacaa
caacaacaacaacaacaacaaaaacaacaagaacaagaacaagaacaagaacaagaacaa
gaacaagaacaagaacaagaacaagaacaagaacaagaacaagaacaagaacaagaacag
caacaagaacagccacaagaacagccacaagaacagcaacaagaacagcaacaagaacag
caacaagaacagcaacaagaacagcaacaagaacagcaacaagaa

DBGET integrated database retrieval system