KEGG   Agrobacterium sp. RAC06: BSY240_3064Help
Entry
BSY240_3064       CDS       T04501                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00071  Fatty acid degradation
agc00072  Synthesis and degradation of ketone bodies
agc00280  Valine, leucine and isoleucine degradation
agc00310  Lysine degradation
agc00362  Benzoate degradation
agc00380  Tryptophan metabolism
agc00620  Pyruvate metabolism
agc00630  Glyoxylate and dicarboxylate metabolism
agc00640  Propanoate metabolism
agc00650  Butanoate metabolism
agc00900  Terpenoid backbone biosynthesis
agc01100  Metabolic pathways
agc01110  Biosynthesis of secondary metabolites
agc01120  Microbial metabolism in diverse environments
agc01130  Biosynthesis of antibiotics
agc01200  Carbon metabolism
agc01212  Fatty acid metabolism
agc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSY240_3064 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    BSY240_3064 (phbA)
   00640 Propanoate metabolism
    BSY240_3064 (phbA)
   00650 Butanoate metabolism
    BSY240_3064 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSY240_3064 (phbA)
   00072 Synthesis and degradation of ketone bodies
    BSY240_3064 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSY240_3064 (phbA)
   00310 Lysine degradation
    BSY240_3064 (phbA)
   00380 Tryptophan metabolism
    BSY240_3064 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSY240_3064 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSY240_3064 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSY240_3064 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:agc04147]
    BSY240_3064 (phbA)
Enzymes [BR:agc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSY240_3064 (phbA)
Exosome [BR:agc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSY240_3064 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOG10289
UniProt: A0A1B3NY56
Position
3157753..3158934
Genome map
AA seq 393 aa AA seqDB search
MSTPSIVIASAARTPVGSFNGALSSVAAHDLGAIAIKAVLERAGVEAGEVDEVILGQILT
AGQGQNPARQAAMKAGIPQEATAWGLNQLCGSGLRAVAIGMQQIATGDARIIIAGGQESM
SMAPHCAHLRNGTKMGDLKMVDTMIKDGLTDAFYGYHMGTTAENVARQWQLTRDEQDAFA
VASQNKAEAAQVAGRFKDEIVPVIVPGRKGDVTVDQDEYIRIGATLESMQKLKPAFDKEG
TVTAGNASGINDGAAVALLMTEAEASRRGIAPLARVVSWATAGVDPKIMGTGPIPASRKA
LEKAGWKISDLDLVEANEAFAAQACAVNKDLGWDTSIVNVNGGAIAIGHPVGASGARILN
TLLFEMKRRGAKKGLATLCIGGGMGVAMCLEAF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgtccatcgttatcgcgagcgctgccagaaccccggtcggatctttcaac
ggggcgttgtcatccgtcgcagcacatgatctcggcgccatcgccatcaaggccgtgctg
gagcgcgccggcgtggaggcgggtgaagtcgacgaagtcattctcgggcagatccttacc
gcagggcagggccagaacccggctcgccaggcagcgatgaaggccggtattccgcaggag
gcgacagcctggggtctcaatcagctctgcggttccggcttgcgtgccgtcgccatcggc
atgcagcagatcgcgacaggcgacgcgaggatcatcattgccggcgggcaggaatcgatg
tcgatggcgccgcactgcgcgcacctgcgcaacggcacaaaaatgggcgacctgaagatg
gtcgacaccatgatcaaggacggccttaccgatgccttctacggatatcacatgggcacg
accgcggaaaatgttgcccggcagtggcagctgacccgtgacgaacaggacgcctttgcg
gtcgcttcgcagaacaaggcggaggccgcccaggttgccggccgtttcaaggacgaaatc
gttcctgtcatcgtgcccggccgcaagggcgacgtcactgtcgatcaggatgagtacatc
cgcatcggtgcgacgctcgaaagcatgcagaagctgaaacccgccttcgacaaggaaggc
acggtcaccgccggcaacgcatccggtatcaatgatggtgcggcggtcgccctgctgatg
accgaggccgaggcttcgcgtcgtggtatcgcgccgctcgcccgtgtcgtctcttgggca
accgcaggtgtcgatccgaagatcatgggcactggcccaatcccggcgtcgcgcaaggcg
cttgagaaggccggctggaagatttccgatctcgacctcgttgaagccaacgaagccttt
gccgcacaggcctgcgccgtgaacaaagatctcggctgggatacctcgatcgtgaacgtc
aatggtggcgcgatcgcgatcggccatccggtcggcgcgtccggcgcccgcattctcaac
acgctgctgttcgagatgaagcgtcgcggcgccaagaagggcctcgccacgctgtgcatc
ggcggtggcatgggtgttgccatgtgcctcgaggcattctga

DBGET integrated database retrieval system