KEGG   Agrobacterium sp. RAC06: BSY240_3152Help
Entry
BSY240_3152       CDS       T04501                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00220  Arginine biosynthesis
agc00330  Arginine and proline metabolism
agc01100  Metabolic pathways
agc01110  Biosynthesis of secondary metabolites
agc01130  Biosynthesis of antibiotics
agc01230  Biosynthesis of amino acids
Module
agc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSY240_3152 (rocF)
   00330 Arginine and proline metabolism
    BSY240_3152 (rocF)
Enzymes [BR:agc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSY240_3152 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AOG08316
UniProt: A0A1B3NSI8
Position
complement(3246250..3247185)
Genome map
AA seq 311 aa AA seqDB search
MAMQQKTVALIGVPLEEGSGRGGCAMGPAAYRIAGIGPAMRDLGYTVEDRGDLRPEPASD
LADMPRAKNLPVVGAFTRAIEAATYEAAASGAVPILLGGDHSLSMGSVSGMVRYASVVGR
PLYVLWLDAHSDFNAPETSPSGNIHGMPVAFFCGKAEFAPILPSERPFVDPRHVYQVGIR
SVDEEERRLISENAVNVYDMRAVDEEGMGSIVKRILADVREANALLHVSLDVDFLDPDVA
PGVGTTVPGGATFREAHLIMELLHDSGLVSSLDLVELNPFLDDRGRSARVMVELAASLFG
RRILDRPTRGG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcaacagaagactgtcgccctcatcggggtaccgctcgaggaaggatcgggc
cgcggcgggtgtgccatggggcctgcagcctatcgcattgccgggatcggtccggccatg
cgtgacctcggctataccgtcgaggatcgcggcgatcttcggccggagccggcatcggat
ctggcggacatgccacgcgccaagaacctgcctgttgtcggcgccttcacccgtgcgatc
gaggccgccacttacgaggcggcggcaagcggtgccgtcccgatcctgctcggcggtgac
cacagcctctccatgggcagcgtttccggcatggtgcgttatgcaagtgtggtgggtcga
ccgctctacgtgctctggttggatgcccattcggacttcaatgcgcctgagacctctccg
tccggcaatatccatggcatgcccgtcgcgttcttctgcggcaaggctgaatttgccccg
atccttccgagcgagcggccattcgtcgatccacggcatgtctaccaggtcggcatccgt
tcggtcgacgaggaggaacgccggctgatctcggagaatgccgtcaatgtctatgacatg
cgcgccgtcgatgaagaggggatgggcagcatcgtcaaacgcatcctggccgatgtccgc
gaggccaacgcgctgctgcatgtcagcctcgatgtcgacttcctcgatcccgacgttgca
cccggcgttggcaccacggttccgggcggcgcgaccttccgcgaggcgcatctgatcatg
gagctcttgcacgacagcgggcttgtctcatccctcgacctcgtcgaactcaacccgttt
ctcgatgaccgaggccgcagcgcccgcgtcatggtggaactggctgcgagcctcttcggc
cgccgcattctggaccgtccgacccgtggcggatga

DBGET integrated database retrieval system