KEGG   Agrobacterium sp. RAC06: BSY240_3670Help
Entry
BSY240_3670       CDS       T04501                                 

Definition
(GenBank) O-methyltransferase family protein
  KO
K09846  demethylspheroidene O-methyltransferase [EC:2.1.1.210]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00906  Carotenoid biosynthesis
agc01100  Metabolic pathways
agc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    BSY240_3670
Enzymes [BR:agc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.210  demethylspheroidene O-methyltransferase
     BSY240_3670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_2 Dimerisation2 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 Methyltransf_24 MarR_2 HTH_20 Methyltransf_31 MTS
Motif
Other DBs
NCBI-ProteinID: AOG10393
UniProt: A0A1B3NYG3
Position
complement(3819006..3820202)
Genome map
AA seq 398 aa AA seqDB search
MDTGGGRGFDASPPIRTSEARADHRQSLLQSVAIGFRLWRSRQIASPRFRAFVSRMPLLR
QIANRKANHLFRLTTGFVHTQILSACVGVGIFEALDGEALSTNAIAARCGMPSDAMRRLL
EQARRLDLVVSLAPDLWLLSDAGTVLAADRGLREMIRHHDMLYRDLADAPAFWRGDRSDT
ELRRYWAYVRGSDPASIGNEEAAPYSALMRESQAMLADCLLASHDFGQYRSVLDVGGGEG
AFLAAIGARHPATRLALFDLPAVTQLATRHLQERGLLTRSRLHPGDFTRDLIPADQDCVT
LVRILCDHDDDRVLKILANLHRHLAPGTHLLVAEAMAGNTDGPNLAAIYFTSYFTAMGSG
RCRTASEIIALLARSGFAGAKVATTTNPLLAGLVIAKR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggataccggaggcggaagaggcttcgatgccagcccgccgatccgcaccagcgaggcg
cgagcggaccatcgacaaagcctcctgcagtcggtggcgatcggttttcgtctctggcga
agccgccagatagcctcgccccgcttccgcgcgttcgtttcgcggatgccgctgctgcgg
cagatcgccaaccgcaaggccaatcatctgtttcgcctgacaacaggcttcgtccacacc
cagatcctgtctgcctgtgtgggtgtcgggatcttcgaggccctggacggcgaggcattg
tccacgaatgcaattgctgcccgctgcggcatgccgtcggacgccatgcggcgtctgctc
gagcaggcaagacggctcgatctcgtcgtcagcctcgcccctgatctctggctgctctcg
gatgccggcacggtgctcgccgccgatcgcggtctgcgggagatgatccggcatcatgac
atgttataccgcgatctcgctgatgcgcccgccttttggcgcggcgatcgcagcgatacc
gaactccgccgctactgggcctatgtgaggggcagcgaccccgccagcatcggcaacgag
gaggccgcaccctactccgcgctgatgcgcgagagccaggcgatgctggccgactgtctc
cttgcatcccacgacttcggccaataccgatccgtactcgatgtcggcggcggcgaaggc
gcattcctcgcagccattggcgcgcggcatcccgcgacacggctcgcgctgttcgatctg
cccgcggtcacacagcttgcaacccgccacctgcaggagcgcggtcttttgacccgcagt
agactgcaccccggtgatttcacgcgcgatctcattccggccgaccaggactgcgtgacg
ctggtccggattctctgcgatcacgatgacgaccgcgtcctgaagatccttgccaacctg
caccggcatctcgcacccggcacccatctcctggtcgcggaagccatggccggcaatacg
gacggccccaacctcgcagccatctatttcaccagttatttcaccgccatgggatccggc
cgctgccggaccgccagtgaaattatcgcactcttggcccgtagcggcttcgccggcgcg
aaggttgccaccacaacaaatcccctcctggcaggccttgtgatcgccaagcgctga

DBGET integrated database retrieval system