KEGG   Agrobacterium sp. RAC06: BSY240_3953Help
Entry
BSY240_3953       CDS       T04501                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00051  Fructose and mannose metabolism
agc00520  Amino sugar and nucleotide sugar metabolism
agc01100  Metabolic pathways
agc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BSY240_3953
   00520 Amino sugar and nucleotide sugar metabolism
    BSY240_3953
Enzymes [BR:agc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BSY240_3953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding FdtA DUF218 PHY
Motif
Other DBs
NCBI-ProteinID: AOG10712
UniProt: A0A1B3NZF2
Position
complement(4127152..4128579)
Genome map
AA seq 475 aa AA seqDB search
MSIKIVPVIMAGGKGTRLWPLSRAAAAKQFIRFLGDETLLQKTLARVSDATIYEAPVIVT
NEDFRFLVAEQAREIGVALDGIILEPEARNTAAAVAAAALIVGERHGSETLIQILPSDHE
ITVDDTYRGCVQKAARAARDGKIVTFGITPTEPATGYGYIEIGDDLDNGVNKVTRFVEKP
KAEVAEKMLASGNYAWNSGMFVFSAGQMIAELETLAPEVLAAVRTSIEKAKGDLDFTRLD
AESFGQSPSISIDYAVMEKTPNAAVVPSPIIWSDLGSWDAIWKLAEGDENGNVVSGNATV
SDTTNSLVMSRNAHLAVQGMEGVAVVASEDAVYVGRLDRAQDVGNLVKMLAADKKTAHLT
ENHPTALRPWGGYTSILNGDRFQVKRLFVHPEKKLSLQKHHHRAEHWVCVKGTAEVTIDD
KVTVLHENQSIYIPQGSVHRLANPGKIRLEVIEVQTGSYLGEDDIIRLVDEFGRS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaagatcgtgccggtcatcatggccggcggcaagggaacaaggctttggccg
ctgtcgcgcgcagccgctgcgaagcagttcatccgcttcctcggcgatgagaccttgctg
cagaagacgctggcccgagtctccgacgcgacgatctatgaagcccctgtcatcgtgacc
aacgaggattttcgtttcctcgtcgccgaacaggcccgcgagatcggtgtcgcgcttgat
ggcatcatcctggagccggaggcgcgcaacaccgcggccgctgtcgccgccgccgctttg
atcgtcggtgagcgccatggcagcgagacgctgatccagatcctgccctccgaccacgag
atcaccgtcgatgatacctatcgcggctgcgtgcaaaaggcggcccgtgcggcgcgcgac
ggcaagatcgtcaccttcggtatcacgccgaccgagccagcaaccggctacggctatatc
gagatcggcgacgacctcgacaatggggtgaacaaggtcacgcgcttcgtcgaaaagccg
aaggcagaggtcgccgaaaagatgctggcgagcggcaactatgcctggaactccgggatg
tttgtcttctccgccggccagatgattgcggagcttgagacactggcgcctgaagttctc
gcggccgtccggacctcgatcgaaaaggccaagggcgatctcgactttacccgccttgat
gcggaaagctttggccaaagcccgagcatctcgatcgactatgcagtcatggagaagacg
ccgaatgcggcggttgtcccctcgcccatcatttggtccgacctcggcagctgggacgcg
atctggaagctcgccgaaggcgatgaaaacggcaatgtcgtcagtggcaacgccaccgtc
tccgacaccaccaattcgctcgtcatgtcgcgcaacgcccatctcgccgtccagggcatg
gaaggtgtcgccgtcgtcgcctccgaagacgccgtctatgttggtcgcctcgaccgggcc
caggatgtcggcaatctcgtcaagatgctcgccgccgacaagaagacggcgcatctcacc
gaaaaccacccaacggcccttcgcccctggggtggctatacctcgatcctcaatggcgat
cgcttccaggtgaagcgcctcttcgtgcatccggaaaagaaactctcgctgcagaagcat
catcaccgtgctgaacactgggtctgcgtcaagggaacggcagaggtcaccatcgacgac
aaggtcactgtcctgcacgagaaccagtcgatctacatcccgcaaggatccgtgcaccgc
ctcgccaatcccggcaagatccgcctcgaagtgatcgaggtccagaccggctcctatctc
ggcgaagacgacatcatccgcctggtcgacgaattcggtcggagctga

DBGET integrated database retrieval system