KEGG   Agrobacterium sp. RAC06: BSY240_3981Help
Entry
BSY240_3981       CDS       T04501                                 

Definition
(GenBank) calcineurin-like phosphoesterase family protein
  KO
K11751  5'-nucleotidase / UDP-sugar diphosphatase [EC:3.1.3.5 3.6.1.45]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00230  Purine metabolism
agc00240  Pyrimidine metabolism
agc00760  Nicotinate and nicotinamide metabolism
agc01100  Metabolic pathways
agc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSY240_3981
   00240 Pyrimidine metabolism
    BSY240_3981
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BSY240_3981
Enzymes [BR:agc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BSY240_3981
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.45  UDP-sugar diphosphatase
     BSY240_3981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C LysM Metallophos PGA_cap PepSY_2
Motif
Other DBs
NCBI-ProteinID: AOG12335
UniProt: A0A1B3P407
Position
complement(4158145..4160043)
Genome map
AA seq 632 aa AA seqDB search
MFRHLKIGLFSASVLALTAGTALADFELNILHINDLHSRIEAISKSDSTCSAKDAAANEC
FGGIARVKAAIDARRAELTGKNVLTLDAGDQFQGSLFYTTYKSAPIADFMNGIGFDAMAI
GNHEFDDGPEELAKFIDALKFPMISGNTLAGLNSPVADKFKPYIVKEFGEEKVAIVSVLA
TDTDETSSPGDTILFADEIGYLKEAVAEIEGQGIDKIVLLSHVGYVKDQEIAAAVDGIDV
IVGGHSHSLLSNTDEKAAGPYPTLVKNPSGADVPIVQAYAYSKYLGDLTVVFDDAGVVKT
ATGEPKLLDASVTPDEGFVAKVAELGGPIEELKLKEIGESAEAIDGSRETCRAVECTMGN
LVADAMVDRLSDQGITIAIQNGGGLRASIDAGTVTMGEVLTVLPFQNTLASFQLKGSDIV
AALENGVSQVEEAAGRFPQVSGLKYTADLTKPAGSRISSVEVKEGDAFVAIDPEKVYGVA
TNNYMRTGGDGYGVFESGGQNAYDFGPGLETVVADYIAKNSPYRPYTDGRITVISATAPP
AGDTTTPATEAPAQAPAATEAPAAAEAPAATAADAAMATAETVYKVVAGDSLWKIAEATY
GDGMMWSKIAEANTLRNPNALSIGRELQLPPK
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgttcagacatttgaagattggccttttcagcgcctcggtgctggccctgaccgccgga
acagctctggccgatttcgaactcaatatcctgcacatcaatgacctgcattcccgcatc
gaggccatcagcaaatccgattcgacctgctcggcaaaagatgcggccgccaacgaatgc
ttcggcggcatcgcccgcgtgaaggccgccatcgatgcgcgccgcgcagaactcacgggc
aagaacgtgctgacactcgacgctggcgaccagttccagggctcgctcttctacaccacc
tacaagagcgccccgattgccgacttcatgaacggcatcggcttcgacgccatggccatc
ggcaaccacgaattcgatgacggcccggaagagctggcgaagttcatcgacgcgctgaaa
ttcccgatgatctccggcaacacgctggctggcctcaactctccggtcgccgacaagttc
aagccctacatcgtcaaggaattcggcgaggagaaggtcgcgattgtctcggtcctcgca
accgacacggacgagacctcctcgcctggcgacaccatcctgtttgccgacgagatcggc
tatctgaaggaagccgtggccgaaatcgaaggccagggcatcgacaagatcgtgctgctc
tcgcatgtcggctacgtcaaggatcaggaaatcgcggcagccgttgacggcatcgacgtg
atcgtcggcggccacagccattcgcttttgtccaataccgacgagaaggcagcgggcccc
tacccgaccctggtgaagaacccgtccggcgcggatgtgccgatcgtccaggcctatgcc
tattccaagtatctcggcgacctgacggtcgtttttgatgacgcaggcgtcgtcaagacc
gcgactggcgaaccgaagctgctagacgcctccgtgaccccggatgaaggcttcgtcgcc
aaggtggccgaactcggtggcccgatcgaggagttgaaactgaaggagatcggcgagagc
gccgaagccatcgacggctcgcgtgaaacctgccgtgcagtcgaatgcaccatgggcaat
ctggtggcggacgccatggtcgatcgcctcagcgatcagggcatcaccatcgccatccag
aatggcggcggtctgcgcgcgtcgatcgacgccggcaccgtcaccatgggcgaggtcctg
acggtgcttcccttccagaacacgcttgcctccttccagctcaagggctccgacatcgtg
gccgccctcgagaacggcgtgagccaggtcgaggaagcggccggccgtttcccgcaggta
tccggtctgaaatacaccgccgacctgaccaagccggccggcagccgcatctcctccgtc
gaggtcaaggaaggtgacgccttcgtcgccattgaccccgagaaggtctacggcgtggcc
accaacaactatatgcgcaccggtggtgatggctatggcgtgttcgagagcggcggacag
aacgcctacgatttcggcccgggcctcgaaactgtcgtggccgactacatcgccaagaac
agcccctacaggccttacaccgacggtcgcatcaccgtgatctccgcgacggcaccgccg
gcaggcgacacgaccacgccggcaaccgaagcgcccgctcaggctccggcagcaaccgag
gctccggctgccgcagaagctccggcggcaaccgccgcggatgcggccatggcgactgcc
gaaaccgtctacaaggtggttgccggcgacagcctctggaagatcgccgaggccacctat
ggtgacggcatgatgtggagcaagatcgccgaggcgaacacgctgcgcaatccgaacgcg
ctctcgatcggccgggaattgcagcttccgccgaagtaa

DBGET integrated database retrieval system