KEGG   Agrobacterium sp. RAC06: BSY240_4523Help
Entry
BSY240_4523       CDS       T04501                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
agc  Agrobacterium sp. RAC06
Pathway
agc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:agc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSY240_4523
Enzymes [BR:agc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BSY240_4523
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BSY240_4523
    1.1.1.-  
     BSY240_4523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AOG12609
UniProt: A0A1B3P4S2
Position
pBSY240_1:complement(75459..76532)
Genome map
AA seq 357 aa AA seqDB search
MRALRFYAAKDLRLEDIPEPKMPGPGQVRVRNRFVGICGTDLHEYSYGPIFIPTKPHPFT
GAHGPQVLGHEFGGVVEAVGEGVNSVAVGDRVSIQPLVMPRSGDYFADRGLFHLSTQLAL
VGLSWDGGGMAEAATVNEYNVQKIPNEMTDEEAALVEPTAVAVYACDRGGVTAGNSVLVT
GAGPIGMLTLLAARAAGATKLFVSDLNDSRLELARKVLPDVITINPKRDKVGDVVRAQTE
GQVGCDVAIECVGNEHALKACVDAVRKQGVVVQTGLHPHENPIDWFQVTFRDLEVKGSWA
YPTHYWPRVISLIASGLLPATKIVTKRITLGSAVKEGFDALLDPAGTHLKILIDLSK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccctgagattttatgccgccaaggacttgcggctcgaagatatccccgagccg
aagatgccgggaccaggtcaggttcgcgttcgcaaccgcttcgtcgggatctgcggaacc
gatcttcacgaatacagctatggcccgatcttcatcccaacaaagccgcatccttttacc
ggcgcccacggcccgcaggtgctcggccatgaattcggcggcgttgtcgaagccgtcggg
gaaggtgtgaactcggttgccgttggcgatcgcgtctcgatccagccgctcgtcatgccg
cgctccggcgactatttcgccgaccgaggcctgttccacctgagcacgcagctggcactg
gtgggcttgagctgggacggcggcggcatggccgaagctgccactgtcaacgaatacaac
gtccagaagatcccgaacgagatgaccgatgaggaggccgcgctcgtcgaaccgacggcc
gttgccgtctatgcctgcgaccgcggcggcgtgaccgccggcaacagcgttctcgtcacc
ggcgccggcccgatcggcatgctgacgctgctcgccgcccgcgcggccggcgcgaccaag
ctgtttgtctccgatctcaacgactcacggctcgaacttgccaggaaggtgctgcccgac
gtcatcacgatcaatccgaagcgcgacaaggtcggcgatgtcgtgcgcgcccagaccgag
ggccaggtcggttgcgacgtcgcgatcgaatgcgtgggcaacgagcatgcgctgaaggct
tgcgtcgatgccgtacgcaagcagggcgtcgtcgtgcagacaggtctgcatccgcacgaa
aaccccatcgactggttccaggtcacatttcgggatcttgaggtgaagggctcctgggcc
tatccgacccactactggccgcgcgtcatcagcctgatcgcctccggcctgctgccggcg
accaagatagtcaccaagcgcatcacgctcggctcggcggtcaaggagggcttcgacgcc
ctccttgacccagccggcacccatttgaagatcctcatcgatctttcgaaataa

DBGET integrated database retrieval system