KEGG   Anseongella ginsenosidimutans: FRZ59_03885Help
Entry
FRZ59_03885       CDS       T06183                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
agd  Anseongella ginsenosidimutans
Pathway
agd00564  Glycerophospholipid metabolism
agd01100  Metabolic pathways
agd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:agd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FRZ59_03885
Enzymes [BR:agd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     FRZ59_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_M23 DUF4131 DUF2207
Motif
Other DBs
NCBI-ProteinID: QEC51573
Position
complement(938100..938756)
Genome map
AA seq 218 aa AA seqDB search
MRFHREGYNTIVITGVAALGLLIIVILLFPDAVAWHFITAGLGIIFLVAILQFFRHPGRL
SPEGGRLVLAPADGKVVVIEETTETEYLKDRRIQVSIFMSPVNVHVNRCPVSGRVKHVRY
FQGKYLVAWHPKSSTENERTTIVIEHGSGVEVLFRQIAGAMARRIRWYLKEGQEVSAGEE
MGFIKFGSRMDVFLPPGTKINVTLGQKVRGGETVLAEL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttcacagagaagggtataataccattgtcattaccggtgtggctgcacttggc
ctgctgatcattgttatactccttttcccggatgcagttgcctggcactttattaccgcc
gggctgggaattatattcctggtggctattctccagtttttcaggcatcccggccggctt
tcgccggaaggcggccgcctggtgctggccccggccgacggtaaagtggtggtcattgag
gaaactaccgaaacggaatacctgaaggaccggcgaatacaggtttccatttttatgtcg
ccggtaaatgtacacgtgaaccgctgccctgtgagcgggcgggtgaaacatgtccggtat
ttccagggaaaatacctggttgcctggcatcccaagtcttctaccgagaacgaacgcacg
acgatagtcatcgagcatggatcaggcgtggaagtgctgttccgccagatcgccggcgcc
atggcgcggcgcatccgctggtatcttaaagaaggccaggaggtaagcgccggcgaagag
atgggctttatcaagttcggttctcgcatggatgtgtttttgcccccgggaaccaaaata
aatgtgacgctcggccagaaagtaaggggcggggaaacggtgcttgccgaactctga

DBGET integrated database retrieval system