KEGG   Anseongella ginsenosidimutans: FRZ59_04850Help
Entry
FRZ59_04850       CDS       T06183                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
agd  Anseongella ginsenosidimutans
Pathway
agd00790  Folate biosynthesis
agd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:agd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FRZ59_04850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:agd04147]
    FRZ59_04850
Enzymes [BR:agd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     FRZ59_04850
Exosome [BR:agd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FRZ59_04850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: QEC51731
Position
1168511..1168744
Genome map
AA seq 77 aa AA seqDB search
MWNESGNKLHRHFEFGNFTEAWGFMTRVALLAEKMDHHPEWTNVYNKVDIWLSSHDAGNI
VTEKDRKLAAKIDELLK
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgtggaacgaatcagggaacaaattacaccggcattttgaattcggaaattttacggaa
gcctggggctttatgaccagggtcgctttgctggccgaaaaaatggatcatcatccggaa
tggacgaatgtgtataacaaagtggatatctggctctcctctcatgatgccgggaatata
gtcacagaaaaggaccgtaaactggcggcgaaaattgatgaactcctgaagtag

DBGET integrated database retrieval system