KEGG   Archangium gephyra: AA314_01577Help
Entry
AA314_01577       CDS       T03948                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
age  Archangium gephyra
Pathway
age00010  Glycolysis / Gluconeogenesis
age00053  Ascorbate and aldarate metabolism
age00071  Fatty acid degradation
age00280  Valine, leucine and isoleucine degradation
age00310  Lysine degradation
age00330  Arginine and proline metabolism
age00340  Histidine metabolism
age00380  Tryptophan metabolism
age00410  beta-Alanine metabolism
age00561  Glycerolipid metabolism
age00620  Pyruvate metabolism
age00625  Chloroalkane and chloroalkene degradation
age00903  Limonene and pinene degradation
age01100  Metabolic pathways
age01110  Biosynthesis of secondary metabolites
age01120  Microbial metabolism in diverse environments
age01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA314_01577
   00053 Ascorbate and aldarate metabolism
    AA314_01577
   00620 Pyruvate metabolism
    AA314_01577
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AA314_01577
   00561 Glycerolipid metabolism
    AA314_01577
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AA314_01577
   00310 Lysine degradation
    AA314_01577
   00330 Arginine and proline metabolism
    AA314_01577
   00340 Histidine metabolism
    AA314_01577
   00380 Tryptophan metabolism
    AA314_01577
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AA314_01577
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AA314_01577
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AA314_01577
Enzymes [BR:age01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AA314_01577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKI99950
UniProt: A0A0G2ZEF2
Position
complement(1863013..1864452)
Genome map
AA seq 479 aa AA seqDB search
MRVVSMEEQGRKNPFQERFERLRSRRWEVSRTSAKERIEKLKKLKRAVVERREALYQAIH
ADFRKPAAEVETSEMLLVLMELDHAIKHLGKWMKPRKVGTPMLLAGTRSEVHSEPKGVVL
IIAPWNYPFQLTISPLVAAVAAGNCVMVKPSEKTPHTAAFLSQLIRDVFDPSEVTVVEGG
AQESQALLELPFDHFFFTGGPRVGRKVMEAAAKHLAGVTLELGGKSPAVVDEHADVKAAA
ERITFGKFLNGGQTCVAPDYVLVHASKEEEFLAKVRETVERFYGKTEEARKSTPDFCRMV
DDAQFSRVNGLLERSVASGVRVVTGGVVDASSRYIAPTVLADVKPEAPIMEEEIFGPVLP
VLRYQQLDEAVRHIRSGTKPLAMYIFSQDKRAVDRLVSETSAGGTCVNTTVVHLTNADLP
FGGIGESGVGNYHGEYGFRTFSHERAVLRQGRIAFLQTFFPPYTDKAKKMQRMASRLFE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggtgagcatggaggagcagggccggaagaatcccttccaggagcgcttcgag
cggctgcgctcccggcgctgggaggtgtcgaggacgagcgcgaaggagcggattgagaag
ctgaagaagctcaagcgcgcggtcgtggagcggcgcgaggcgctctaccaggccatccac
gcggacttccgcaagccggcggccgaggtggagacgagcgagatgctgctggtgctgatg
gagctggaccacgccatcaagcacctgggcaagtggatgaagccgcgcaaggtgggcacg
ccgatgctgctcgccggcacgcgcagcgaggtgcactccgagcccaagggcgtggtgctc
atcatcgccccgtggaactaccccttccagctgaccatctccccgctggtggcggcggtg
gcggcgggcaactgcgtgatggtgaagccgagcgagaagacgccgcacacggcggccttc
ctctcgcagctcatccgggacgtgttcgacccctcggaggtgacggtggtggagggaggc
gcgcaggagagccaggcgctgctggagctgcccttcgatcacttcttcttcaccgggggc
ccgcgggtggggcgcaaggtgatggaggcggcggcgaagcacctggccggggtgacgctg
gagctgggcggcaagtcgcccgcggtggtggacgagcacgcggacgtgaaggccgcggcc
gagcgcatcaccttcggcaagttcctcaacgggggccagacgtgcgtggcgccggactac
gtgctggtacacgcctcgaaggaggaggagttcctcgcgaaggtgcgcgagacggtggag
cgcttctacgggaagacggaggaggcgcggaagtccacgccggacttctgccgcatggtg
gatgacgcgcagttctcccgggtgaacgggctgctggagcgctcggtggccagcggggtg
cgcgtggtgacgggcggcgtggtggacgcctccagccgctacatcgcccccacggtgctc
gcggacgtgaagccggaggcccccatcatggaggaggagatcttcggcccggtgctgccc
gtgctgcgctaccagcagctggacgaggcggtgcggcacatccgctcgggcaccaagccc
ctggccatgtacatcttcagccaggacaagcgggcggtggaccgtctcgtttcggagacg
tccgcgggaggcacgtgcgtgaacacgacggtggtgcacctgacgaacgcggacctgccc
ttcggcggcatcggcgagagcggcgtgggcaactaccacggcgagtacggcttccggacc
ttcagccatgaacgggcggtgttgcgccaggggcgcattgccttcctgcagaccttcttc
ccgccgtacacggacaaggcgaagaagatgcagcgcatggccagccgcctcttcgagtag

DBGET integrated database retrieval system