KEGG   Archangium gephyra: AA314_01782Help
Entry
AA314_01782       CDS       T03948                                 

Definition
(GenBank) Hypothetical protein
  KO
K15911  tuberculosinol/isotuberculosinol synthase [EC:3.1.7.8 3.1.7.9]
Organism
age  Archangium gephyra
Brite
KEGG Orthology (KO) [BR:age00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AA314_01782
Enzymes [BR:age01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.7  Diphosphoric-monoester hydrolases
    3.1.7.8  tuberculosinol synthase
     AA314_01782
    3.1.7.9  isotuberculosinol synthase
     AA314_01782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKJ00156
UniProt: A0A0G2ZEY2
Position
complement(2112042..2112629)
Genome map
AA seq 195 aa AA seqDB search
MAMLVRERELLAPYLQNGWRLRLLGAESLPELRPLAEEFAAATPRGEHTLWCSIVAESGA
PWNELLQAVVRTGSRTREDAIRALYGEDIPLASLMVAFGKPLVSPEQVPPLLAGKMDCYF
TQRPGYRITEREFRTILHDHAYVRRTWRPDKTGRAEEATEFRRAWEEGPLLGLGIRLGPF
WYPAPLALPLEELPE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggcgatgctcgtccgggagcgggaattgctcgcgccctacctccagaatggatggcgc
ctgcggctgctgggcgcggagagcctgccggagctgcggcccctcgccgaggagttcgcg
gcggcaacgcctcggggagagcacaccttgtggtgctcgatcgtggcggagtcgggagca
ccctggaacgagctgctccaggcggtggtgcgcacgggctcccggacgcgcgaggacgcc
atccgcgcgctctacggtgaggacatccccctggcctccctgatggtggcctttggcaag
cccctggtgtctccggagcaggtgcctccgttgctggcgggcaagatggactgctacttc
acgcagcggcccggctaccgcatcaccgagcgggagttccgcaccatcctccacgaccac
gcctacgtgcggcgcacctggcgcccggacaagacgggccgggccgaggaggccacggag
ttccgccgcgcgtgggaggagggccccctgttggggctcggcatccggctggggcccttc
tggtatccggccccgctggcgttgcccctcgaggagctccccgagtag

DBGET integrated database retrieval system