KEGG   Archangium gephyra: AA314_02162Help
Entry
AA314_02162       CDS       T03948                                 

Definition
(GenBank) Sugar kinase
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
age  Archangium gephyra
Pathway
age00230  Purine metabolism
age01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AA314_02162
Enzymes [BR:age01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     AA314_02162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AKJ00536
UniProt: A0A0G2ZG23
Position
complement(2563405..2564340)
Genome map
AA seq 311 aa AA seqDB search
MSALICGSLAYDTIMVFQDQFKNHILPDKVHILSVSFLVPRMRREFGGCAGNIAYNLKLL
GGDPVPMATVGQDFAPYRAHFEKCGIRLDQVRVLEDMFTPQAFITTDLDNNQLTAFHPGA
MSRSHDNHVRDVKGITFGIVAPDCHDGMLQNAREFHDCGIPFIFDPGQMMPLFNGDEFRH
FIELADYIVVNDYESNLLQERTGWDEAAIASKVRAYIITRGPRGSRILTRSECHEIPPAR
ERQVVDPTGCGDAYRAGLILGLMRGLDLPTCGRMASLMGALKVEHPGTQNQKFTYDEFAA
RFREQFGYALD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgctgatctgcggctcgctggcctacgacaccatcatggtgttccaggaccag
ttcaagaaccacatcctgccggacaaggtgcacatcctgagcgtgtccttcctggtcccg
cggatgcgccgcgagttcggcggctgcgccggcaacatcgcctacaacctcaagctcctc
ggcggcgacccggtgcccatggcgacggtcggccaggacttcgcgccctaccgcgcccat
ttcgagaagtgtggcatccgcctcgatcaggtccgcgtgctcgaggacatgttcaccccc
caggcgttcatcaccaccgacctcgacaacaaccagctcacggccttccacccgggcgcg
atgagccgcagccacgacaaccacgtgcgcgacgtgaagggcatcaccttcggcatcgtc
gcgccggactgccacgacggcatgctgcagaacgcccgggaattccacgactgcggcatc
cccttcatcttcgatcccggccagatgatgccgctgttcaacggcgacgagttccgccat
ttcatcgagctggccgactacatcgtcgtcaacgactacgagtcgaacctgctccaggaa
cgcaccggctgggacgaggcggccatcgcctccaaggtccgtgcctacatcatcacgcgt
ggcccgcgcggctcgcggatcctcacgcggagcgaatgccatgagatccctccggcacgc
gagcgccaggtggtcgacccgaccggctgcggcgatgcctaccgtgccggcctgatcctc
ggcctgatgcgcggcctcgacctacccacctgcggccgcatggcctcgctgatgggcgcg
ctcaaggtcgagcaccccggcacgcagaaccagaagttcacctacgacgaattcgccgcg
aggttccgcgagcagttcggctacgcgctcgactga

DBGET integrated database retrieval system