KEGG   Archangium gephyra: AA314_02918Help
Entry
AA314_02918       CDS       T03948                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
age  Archangium gephyra
Pathway
age00970  Aminoacyl-tRNA biosynthesis
age01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:age00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AA314_02918
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:age03029]
    AA314_02918
Enzymes [BR:age01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AA314_02918
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AA314_02918
Mitochondrial biogenesis [BR:age03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AA314_02918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKJ01292
UniProt: A0A0G2ZMI2
Position
3550498..3551958
Genome map
AA seq 486 aa AA seqDB search
MQLTDLTLLELASKLASGETTSVEATRACLARIAQVDGKVKAFLRLDEHGALAAAEASDA
RRKNGNPLGPLDGVPVAVKDIFLTEGVETTCASRVLEGFVPPYDATAVRLLKEAGTPILG
KLNQDEFAMGSSNESSAYGPCHNPWDVTRTPGGSSGGSAAALAAREVFGTLGTDTGGSIR
QPAAFTNTVGIKPTYGRVSRYGVIAYASSLDAPGPMARTVGDVAALLQVLARHDPRDSTS
APADVPDYLADLEHGVAGLKLGVPREYFVEGMDPEVEASVREALKAYERLGATLVDVSLP
HTKYALATYYLLAPAEASSNLARYDGVRYGRRAREVKGLRDMYGETRDQGFGPEVKRRIM
LGTYALSAGYYDAYYLRAQKVRTLIREDFTKAFTQVDALVTPTSPVPAFKLGEKVNDPLS
MYLMDVCTLPCNLAGLPGVSLPCGFTKAGLPIGLQLMGRPFDEAKLLRIARAFEREHDYV
RRPAPI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaccgacctcaccctgctggagctggcgtcgaagctggcctcgggggaaacc
acctccgtggaggccacgcgggcatgcctcgcgcgcatcgcccaggtggacgggaaggtg
aaggccttcctgcggctggacgagcacggcgcgctggctgccgccgaggccagtgacgca
cgccgcaagaacggcaacccgctcgggccgctggacggcgtgccggtggccgtgaaggac
atcttcctcaccgagggcgtggagacgacgtgtgcctcgcgcgtcctcgagggcttcgtc
cccccatacgacgccaccgcggtacggctgttgaaggaggcggggacgcccatcctgggc
aagctcaaccaggacgagttcgcgatgggctcgtccaacgagtcgagcgcctatggcccg
tgccacaacccctgggacgtgacgcgcacgccgggaggctcctcgggaggctcggcggcg
gcgctggcggcgcgcgaggtgttcggcacgctgggcacggacacgggcggctccatccgc
cagcccgctgcgttcaccaacaccgtgggcatcaagcccacctacgggcgcgtgtcgcgc
tacggtgtcattgcctacgcctcctcgctggatgcgccgggccccatggctcgtaccgtg
ggggacgtggcggcgctgctgcaggtgctggcgcggcatgatccgcgggactccacctcg
gcgccggcggacgtgccggactacctggcggacctggagcacggggtggccgggctgaag
ctgggcgtgccccgtgagtacttcgtcgagggcatggaccccgaggtggaagcctccgtg
cgcgaggccctgaaggcctacgagcggctgggcgccacgctggtggacgtgtcgctgccg
catacgaagtacgcgctggccacctactacctgctggccccggcggaggcctcgagcaac
ctggcccgctacgacggcgtgcgctacggccggcgggcgcgggaggtgaagggcctccgg
gacatgtatggcgagacgcgtgaccagggcttcggccccgaggtgaagcgccgcatcatg
ttgggcacctacgcgctgagcgcgggctactacgacgcctactacctcagggcccagaag
gtgcggacgctcatccgcgaggacttcacgaaggccttcacccaggtggacgcgctggtg
acgcccacctcgccggtgccggccttcaagctgggcgagaaggtgaatgatccgctgtcc
atgtacctcatggacgtgtgcacgctgccgtgcaacctggcgggactgcccggcgtgtcg
ctgccgtgcggcttcacgaaggcgggcctgcccatcgggttgcagctcatgggccgcccg
ttcgacgaggcgaagttgctgagaatcgcccgggccttcgagcgcgagcacgactacgtg
cgccgcccggcccccatctag

DBGET integrated database retrieval system