KEGG   Archangium gephyra: AA314_05206Help
Entry
AA314_05206       CDS       T03948                                 

Definition
(GenBank) Glutathione peroxidase family protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
age  Archangium gephyra
Pathway
age00480  Glutathione metabolism
age00590  Arachidonic acid metabolism
age01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AA314_05206
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AA314_05206
Enzymes [BR:age01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AA314_05206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA Rnk_N
Motif
Other DBs
NCBI-ProteinID: AKJ03580
UniProt: A0A0G2ZVN3
Position
complement(6520007..6520561)
Genome map
AA seq 184 aa AA seqDB search
MNEKIANLPLERIDGTKTSLAAFKGKVLLVVNVASQCGLTPQYEGLEKLYKNHQARGLVV
MGFPANEFGAQEPGTNAEIQEFCRSKFGIDFPMFSKLVVKGEGQHPLYQHLTETLPEARF
PANSTLRARLEQYGMKQQKPNDILWNFEKFLINRQGDVVARFSPDTAPDDPALLQALEAE
LARA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaagatcgcgaacctgccgctcgagcgcatcgacggaaccaagacctcgctg
gccgccttcaagggcaaagtgctcctggtggtcaacgtggcctcgcagtgcggcctgacg
ccccagtacgagggcctggagaagctctacaagaaccaccaggcccgggggctggtggtg
atgggctttcccgccaatgagtttggcgcccaggagccgggcaccaacgcggagatccag
gagttctgccgctccaagttcgggatcgacttccccatgttctcgaagctcgtcgtcaag
ggagaaggccagcacccgctctaccagcacctgacggagaccctccccgaggcgcgcttt
cccgccaacagcaccctgcgcgcccgcctggagcagtacggcatgaagcagcagaagccc
aacgacatcctctggaacttcgagaagttcctcatcaaccgccagggcgacgtggtggcg
cgcttctctccggacacggctccggatgaccccgcgctgctccaggccctcgaggcggag
ctcgcccgggcctga

DBGET integrated database retrieval system