KEGG   Archangium gephyra: AA314_05492Help
Entry
AA314_05492       CDS       T03948                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
age  Archangium gephyra
Pathway
age00071  Fatty acid degradation
age00072  Synthesis and degradation of ketone bodies
age00280  Valine, leucine and isoleucine degradation
age00310  Lysine degradation
age00362  Benzoate degradation
age00380  Tryptophan metabolism
age00620  Pyruvate metabolism
age00630  Glyoxylate and dicarboxylate metabolism
age00640  Propanoate metabolism
age00650  Butanoate metabolism
age00900  Terpenoid backbone biosynthesis
age01100  Metabolic pathways
age01110  Biosynthesis of secondary metabolites
age01120  Microbial metabolism in diverse environments
age01130  Biosynthesis of antibiotics
age01200  Carbon metabolism
age01212  Fatty acid metabolism
age02020  Two-component system
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA314_05492
   00630 Glyoxylate and dicarboxylate metabolism
    AA314_05492
   00640 Propanoate metabolism
    AA314_05492
   00650 Butanoate metabolism
    AA314_05492
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AA314_05492
   00072 Synthesis and degradation of ketone bodies
    AA314_05492
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AA314_05492
   00310 Lysine degradation
    AA314_05492
   00380 Tryptophan metabolism
    AA314_05492
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AA314_05492
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AA314_05492
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AA314_05492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:age04147]
    AA314_05492
Enzymes [BR:age01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AA314_05492
Exosome [BR:age04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AA314_05492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKJ03866
UniProt: A0A0G2ZQH6
Position
complement(6874731..6875909)
Genome map
AA seq 392 aa AA seqDB search
MAREVVIVGAARTPIGAFQGALSKLTAPQLGAIAIKAALERSGVSPAQVNETIMGCVLQA
GVGQAPARQAAIYAGIPETVPAVTINKVCGSGLKAVIAGAQAIALGDAEVVVVGGMESMS
NAPYVSHSMRGGARMGNVEFKDAMILDGLWDPYGNVHMGSCAEECSVTQGISRANQDEYA
LESTKRAIEAQKAGLFTREIVPVTVPGGKGGDVVVSEDEGPKNAKPDKIPTLKPVFKKDG
TVTAANASSINDGAAALVLMSAERAKAEGRTVLGRIAGYAGAARKPVEFTIAPADSINNL
LKKTGHKTTDVDLWEINEAFAVVALANNKLLGLEASKVNVRGGAVVLGHPIGASGARLLV
TLVHTLQDTNKKRGVASLCIGGGEGIALMVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgaagtggtcatcgtcggcgcggcgcgtacccccatcggggccttccagggc
gccctgtccaagctgacggcgccccagctcggcgccatcgccatcaaggcggcgctggag
cgctcgggtgtctctcccgctcaggtcaacgagacgatcatgggctgcgtgctgcaggcg
ggcgtgggccaggccccggcgcgtcaggcggccatctacgccggcatccccgagaccgtt
cccgccgtcaccatcaacaaggtgtgtggctcgggcctcaaggcggtcatcgccggcgcc
caggcgatcgcgctgggtgacgccgaggtggtggtggtcggcggcatggagtccatgagc
aacgcgccctacgtgagccactcgatgcgtggcggcgcccgcatgggcaacgtggagttc
aaggacgcgatgatcctcgacggcctgtgggatccctacggcaacgtccacatgggcagc
tgcgccgaggagtgctccgtcacccagggcatcagccgcgccaaccaggacgagtacgcg
ctggagtccaccaagcgcgccatcgaggcccagaaggccggcctgttcacccgcgagatc
gtccccgtcaccgtgcccggtggcaagggcggtgacgtggtggtgagcgaggacgagggc
ccgaagaacgccaagccggacaagatccccacgctcaagcccgtcttcaagaaggacggc
acggtgacggcggccaacgcctcctccatcaacgacggcgccgcggcgctggtgctaatg
agcgccgagcgcgccaaggccgagggccgcaccgtcctgggccggatcgccggctacgcc
ggggccgcccgcaagccggtggagttcaccatcgctccggcggactccatcaacaacctg
ctcaagaagaccggccacaagaccaccgacgtggacctgtgggagatcaacgaggcgttc
gcggtggtggccctggccaacaacaagctgctcggcctggaggcctcgaaggtgaacgtg
cgcggcggcgcggtggtgctcggccacccgatcggcgcctcgggcgcgcgcctgctggtg
acgctggtgcacacgctgcaggacacgaacaagaagcgcggcgtggcgtcgctctgcatc
ggcggcggcgagggcatcgcgctgatggtggagcgctag

DBGET integrated database retrieval system