KEGG   Archangium gephyra: AA314_06539Help
Entry
AA314_06539       CDS       T03948                                 

Definition
(GenBank) Glycyl-tRNA synthetase alpha chain
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
age  Archangium gephyra
Pathway
age00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:age00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AA314_06539
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:age01007]
    AA314_06539
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:age03016]
    AA314_06539
Enzymes [BR:age01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AA314_06539
Amino acid related enzymes [BR:age01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AA314_06539
Transfer RNA biogenesis [BR:age03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AA314_06539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AKJ04913
UniProt: A0A0G2ZTH1
Position
complement(8222658..8223638)
Genome map
AA seq 326 aa AA seqDB search
MYFQDLILTLQNHWAKQGCIITQPYDLEVGAGTMHPATFLRALGPEPWNVAYVQPSRRPA
DGRFGENPNRLFQHHQFQVILKPAPKNVQQLYLDSIRAFGIDPLEHDIRFVEDDWESPTL
GAWGLGWEVWCDGMEVTQFTYFQQCGGFECRPVAAELTYGLERIAMYLQNVENIYDIEWV
KGVKYREIFHANEVEMSRYALQESDPQMLFGLFDAYEKECKRLIEREVPLPAYDYALKCS
HAFNLLDARGAISVTERANFIKRVRDNARLCAEGYLKMREKLGFPLLKTPWTVGEQPPVL
EGKAASEYWKTVTFNKPAEAEVARGK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtacttccaggatctcatcctcacgctccagaatcactgggcgaagcaagggtgcatc
atcacccagccctatgatctcgaagtgggtgcgggcaccatgcacccggccaccttcctc
cgcgccctgggccccgagccctggaacgtggcgtacgtgcagccctcgcggcgtcccgcc
gacggccggttcggcgagaaccccaaccgcctgttccagcaccaccagttccaggtcatc
ctcaagcccgcgcccaagaacgtccagcagctctacctggactccatccgcgcgttcggc
atcgatcccctcgagcacgacatccgtttcgtcgaggacgactgggagtcgcccaccctg
ggggcctggggcctgggctgggaggtctggtgtgacggcatggaggtcacccagttcacc
tacttccagcagtgcggtggtttcgagtgccggcccgtcgcggcggagctgacgtacggc
ctcgagcgcatcgccatgtacctgcagaacgtggagaacatctacgacatcgagtgggtc
aagggcgtcaagtaccgcgagatcttccacgccaatgaagtggagatgagccggtacgcc
ctccaggagtcggacccgcagatgctgttcggcctgttcgacgcctacgagaaggagtgc
aagcgcctcatcgagcgcgaggttccgctgcccgcgtatgactacgcgctcaagtgctcg
cacgccttcaacctgctggacgcgcgcggggccatctcggtgacggagcgcgccaacttc
atcaagcgcgtgcgcgacaacgcgcgcctgtgcgccgagggctacctgaagatgcgcgag
aagctcggcttcccgctgctcaagacgccctggacggtgggcgagcagccgccggtgctc
gagggcaaggccgccagcgagtactggaagacggtgaccttcaacaagcccgccgaggcg
gaggtggcccgtggcaagtga

DBGET integrated database retrieval system