KEGG   Archangium gephyra: AA314_06618Help
Entry
AA314_06618       CDS       T03948                                 

Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
age  Archangium gephyra
Pathway
age00670  One carbon pool by folate
age01100  Metabolic pathways
age01120  Microbial metabolism in diverse environments
age01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:age00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AA314_06618
Enzymes [BR:age01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AA314_06618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AKJ04992
UniProt: A0A0G2ZY61
Position
8325593..8326465
Genome map
AA seq 290 aa AA seqDB search
MKIRNRLNPSNPCFSFEFFPPKTDEGTANLLKTLEDLAPLEPGFVSVTYGAGGSTRDRTL
ELVTRIKRETGIEAMAHITCVGHTPGELRDVLQRLEEAKLENVLVLRGDPPRGQTAFEPV
PGGFRHASELVRFIREEDFNFCLGGACYPEGHVETASRDDDLRHLKEKVDAGLDFVITQL
FFDNAFYFDFVERARRMGINVPIVPGIMPITNYEQVHRFTRMCGATVPMRLGLQLERVKD
QPEALVQLGVAHATVQCMELLSRGVPGIHFYTLNKSPATRMIVSALRART
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgtaatcgtttgaatccgtccaacccctgtttctccttcgagttcttcccg
cccaagacggacgagggcacggccaacctgctgaagacgctggaggacctggcgcccctg
gagccgggcttcgtgtccgtcacctacggcgcgggcgggagcacccgggacaggacactg
gagctcgtcacccgcatcaagcgcgagacgggcatcgaggccatggcccacatcacctgc
gtgggccacacgcccggcgagctgcgcgacgtgctgcagcggctcgaggaggcgaagctg
gagaacgtgctggtgctccggggagatccgccccgggggcagacggccttcgagcccgtg
cccgggggtttccgtcatgcctccgagttggtgcgcttcatccgggaggaggatttcaac
ttctgcctgggcggggcgtgctatccggagggccacgtggagacggcctcgcgcgacgac
gacctgcgtcatctcaaggaaaaggtggacgcgggcctggacttcgtcatcacccagctc
ttcttcgacaacgccttctacttcgacttcgtggagcgggcgcgccgcatgggcatcaac
gtccccatcgtcccgggcatcatgcccatcaccaactacgagcaggtgcatcgcttcacc
cgcatgtgcggggccacggtgcccatgcgcctggggctccagctcgagcgcgtgaaggat
cagcccgaggcgctggtgcagctgggggtggcgcacgccacggtgcagtgcatggagctg
ctgtcgcgcggcgtgccgggcatccacttctacacgctcaacaagtcaccggcgacgcgg
atgatcgtgagcgccctgagggcccgcacatga

DBGET integrated database retrieval system